Anticorps primaires

The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.

Lipoprotein Lipase Monoclonal Antibody Biotin

CD45 antibody (FITC) was raised in Rat using as exon C-dependent epitope of CD45 glycoprotin as the immunogen.

Affinity purified Rabbit polyclonal Kininogen 1 antibody

Affinity purified Rabbit polyclonal INPP1 antibody

Armenian Hamster monoclonal CD80 antibody (FITC)

The TRPA1 antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the TRPA1 protein, which plays a crucial role in various physiological processes. This antibody has been extensively tested and validated for use in techniques such as immunohistochemistry, Western blotting, and immunofluorescence.

Rat monoclonal CD71 antibody (allophycocyanin)

The CD68 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD68, a glycoprotein that is expressed on the surface of activated macrophages, adipose tissue cells, and certain types of collagen. This antibody is widely used in research and diagnostic applications to detect the presence of CD68 in various biological samples, such as human serum or tissues.

ACTL6B antibody was raised using the middle region of ACTL6B corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL

Mouse monoclonal SERPINB4 antibody

Mouse monoclonal PYCRL antibody

Rabbit polyclonal TLP11 antibody

AXL antibody was raised in Mouse using a purified recombinant fragment of AXL(aa466-530) expressed in E. coli as the immunogen.

Mouse monoclonal LENG1 antibody

Rabbit polyclonal SLC25A6 antibody

Rabbit polyclonal NOP2 antibody

The NMDAR1 antibody is a monoclonal antibody that targets the N-methyl-D-aspartate receptor subtype 1 (NMDAR1). This receptor is involved in various physiological processes, including synaptic plasticity and learning. The NMDAR1 antibody has been shown to inhibit the activation of NMDAR1 and reduce microvessel density in tumors by blocking the binding of growth factors to their receptors. It has also been demonstrated to modulate the expression of histidine, epidermal growth factor, and steroid receptors in granulosa cells. In addition, this antibody can activate e-cadherin and β-catenin signaling pathways, which are important for cell adhesion and migration. Overall, the NMDAR1 antibody offers promising applications in life sciences research and provides valuable insights into cellular mechanisms related to growth and development.

The FOXP1 antibody is a highly effective and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP1 protein, which plays a crucial role in various cellular processes. This antibody binds to the nuclear-activated FOXP1 protein, allowing for its detection and analysis.

C1R antibody is a polyclonal antibody that targets the C1R protein complex. It has neutralizing properties and can be used in various life science applications. This antibody has been shown to inhibit the activity of interferon, TNF-α, and interleukin-6. It can be used in research studies to investigate the role of C1R in different biological processes. The C1R antibody is highly specific and reliable, making it an essential tool for researchers working with biomolecules. Whether you are studying dopamine signaling or exploring the effects of haloperidol and droperidol, this antibody will provide accurate and reproducible results.

Mouse monoclonal MIF4GD antibody

Somatostatin antibody was raised in sheep using somatostatin conjugated to carrier protein as the immunogen.

PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ

alpha 1 Antiplasmin antibody was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.

The FAM126A antibody is a highly specific monoclonal antibody that targets the FAM126A protein. This antibody has been developed for use in various applications, including immunohistochemistry, Western blotting, and ELISA. It acts as an inhibitory factor by neutralizing the activity of FAM126A.

The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.

MAGEA10 antibody was raised in Rabbit using Human MAGEA10 as the immunogen

CD11c antibody (FITC) was raised in Mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.

The STK4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets mycoplasma genitalium and has been shown to neutralize its effects. This antibody can be used in various applications, including the study of epidermal growth factor and collagen. Additionally, it has been found to have inhibitory properties against other growth factors such as TGF-beta. The STK4 antibody is also cytotoxic and can induce lysis in targeted cells. Researchers can use this antibody to investigate the role of specific proteins or pathways in cellular processes and disease development.

The Notch 1 antibody is a substance used in Life Sciences research and development. It is specifically designed to target and bind to the Notch 1 antigen, which plays a crucial role in cell signaling and development. By inhibiting the activity of Notch 1, this antibody can help researchers gain a better understanding of various biological processes.

LSS antibody was raised in Rabbit using Human LSS as the immunogen

H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids KKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLV

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its potency has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

Affinity purified Rabbit polyclonal KRR1 antibody

COTL1 antibody was raised in Rabbit using Human COTL1 as the immunogen

Purified Polyclonal PKAC alpha/beta antibody

Affinity purified Rabbit polyclonal PP1C gamma antibody

Rabbit polyclonal Rhombotin 1 antibody (HRP)

Rabbit polyclonal TRIP13 antibody

Rabbit polyclonal IFNG antibody (biotin)

CASC3 antibody was raised using the N terminal of CASC3 corresponding to a region with amino acids MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPS