Anticorps primaires

ITGA5 antibody was raised in Rabbit using Human ITGA5 as the immunogen

ALOX15B antibody was raised using the N terminal of ALOX15B corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE

Human serum albumin antibody (HRP) was raised in rabbit using human serum albumin as the immunogen.

MFAP5 antibody was raised in Rabbit using Human MFAP5 as the immunogen

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS

Affinity purified Rabbit polyclonal PEX6 antibody

Affinity purified Rabbit polyclonal Proteasome 20S alpha 6 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied and proven to have high human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Affinity purified Rabbit polyclonal NDUFB9 antibody

Rabbit polyclonal KCNA4 antibody

Cdk7 antibody was raised in mouse using recombinant C-terminal 221 aa fragment of human wild-type cdk7/CAK (cyclin activating kinase) as the immunogen.

Caspase 1 antibody is a highly specific antibody that targets caspase 1, an enzyme involved in the inflammatory response. This antibody has been extensively tested and validated using human serum samples. It has been shown to effectively detect and quantify caspase 1 levels in various biological samples.

The CCR4 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize neurotrophic factors in the body. It specifically targets and inhibits the activity of TGF-β1, a key factor involved in cholinergic signaling. This antibody binds to specific receptor molecules on cells, preventing the activation of downstream signaling pathways and ultimately leading to a reduction in neurotrophic factor activity.

CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen

Rabbit polyclonal ZFYVE27 antibody

Mouse monoclonal PSMB9 antibody

The RBP1 antibody is a highly specialized polyclonal antibody that is used in various life sciences assays. It is specifically designed to target and bind to the RBP1 protein, which plays a crucial role in glucose transportation and dopamine regulation. This antibody is produced by immunizing animals with the specific antigen, resulting in the generation of high-affinity antibodies that can recognize and bind to the target protein.

Affinity purified Rabbit polyclonal SGTA antibody

Mouse monoclonal GBA3 antibody

AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

The Heroin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to heroin, an opioid drug derived from morphine. This antibody can be used for various applications, including research, diagnostics, and therapeutic purposes.

CSH2 antibody was raised in Rabbit using Human CSH2 as the immunogen

SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

MCP2 antibody was raised in mouse using highly pure recombinant human MCP-2 as the immunogen.

Rabbit polyclonal NFKB p105/p50 antibody (Ser927)

Rabbit polyclonal PPPDE1 antibody

APLF antibody was raised in Rabbit using Human APLF as the immunogen

Mouse monoclonal CD20 antibody (biotin)

EGFL8 antibody was raised using the C terminal of EGFL8 corresponding to a region with amino acids QAGAWVRAVLPVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACS

CD25 antibody is a drug that targets the IL-2 receptor, which is involved in immune system activation. It is an anti-CD25 antibody that has been developed as a potential treatment for various diseases, including cancer. CD25 antibody works by blocking the IL-2 receptor and preventing the binding of IL-2, a growth factor that stimulates the proliferation and activation of immune cells. This inhibition of IL-2 signaling can help regulate immune responses and potentially suppress autoimmune reactions. CD25 antibody is a monoclonal antibody, meaning it is produced from a single clone of cells and specifically targets the CD25 antigen on immune cells. It has shown promising results in preclinical studies and is being investigated as a potential therapeutic option in Life Sciences research. The use of CD25 antibody in combination with other drugs, such as histone deacetylase inhibitors or C-C chemokine receptor antagonists, may enhance its efficacy and provide additional benefits.

The RBBP9 antibody is a highly specialized monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. This antibody specifically targets RBBP9, a protein that has been found to play a crucial role in several cellular processes.

The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.

MYOT antibody was raised in Rabbit using Human MYOT as the immunogen

AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT

GFP antibody (HRP) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.

Rabbit polyclonal TCF7 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

Affinity purified Rabbit polyclonal Lipocalin 1 antibody

The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.

NUDT6 antibody was raised in rabbit using the middle region of NUDT6 as the immunogen

Affinity purified Rabbit polyclonal ABH1 antibody

Affinity purified Rabbit polyclonal NDUFA1 antibody

CCNH antibody was raised in Rabbit using Human CCNH as the immunogen