Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
CD62E antibody
The CD62E antibody is a monoclonal antibody that has antiviral properties and is commonly used in research and medical applications. It specifically targets the CD62E protein, also known as E-selectin, which plays a crucial role in immune response and inflammation. This antibody works by binding to the CD62E protein, preventing its interaction with other molecules involved in immune cell adhesion and migration.Phytase antibody
Phytase antibody is a monoclonal antibody that targets and inhibits the activity of phosphatase enzymes. It has been shown to reduce microvessel density and inhibit the growth of blood vessels in tumors. This antibody specifically binds to sclerostin, a protein involved in bone metabolism, and has been found to increase bone mineral density. Additionally, phytase antibody has shown potential as a therapeutic agent for various diseases such as cancer and autoimmune disorders by targeting chemokines, collagen, alpha-fetoprotein, and interleukins. Its cytotoxic effects make it a promising candidate for targeted cancer therapy.RBM47 antibody
RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
NGAL antibody
The NGAL antibody is a powerful multidrug antibody that has been specifically designed to target and neutralize activated antibodies in the body. This unique antibody has shown great potential in the field of Life Sciences, particularly in the development of monoclonal antibodies for therapeutic purposes. The NGAL antibody has been found to inhibit the activity of necrosis factor-related apoptosis-inducing antibodies, which are known to play a critical role in various diseases.MEF2C antibody
The MEF2C antibody is a cytotoxic monoclonal antibody that targets the MEF2C protein. It has been shown to have multidrug resistance and can inhibit the production of interleukin-6 and chemokines. This antibody specifically binds to the p38 mitogen-activated protein and glycoprotein receptors, leading to cell death in cancer cells. Additionally, it has been found to have an inhibitory effect on steroid and fibronectin synthesis, which are important for tumor growth and metastasis. The MEF2C antibody is widely used in life sciences research and shows promise as a potential therapeutic agent in cancer treatment, particularly in combination with other monoclonal antibodies like trastuzumab.Streptococcus Group A antibody (biotin)
Streptococcus group A antibody (biotin) was raised in rabbit using group A Streptococci as the immunogen.
Degré de pureté :Min. 95%Goat anti Human IgE (epsilon chain) (Alk Phos)
This antibody reacts with heavy chains on human IgE (epsilon chain).
Degré de pureté :Min. 95%beta 2 Microglobulin antibody
beta 2 Microglobulin antibody was raised using the N terminal of B2M corresponding to a region with amino acids MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF
Degré de pureté :Min. 95%CD107b antibody (FITC)
CD107b antibody (FITC) was raised in rat using glycoproteins purified from BALB/c mouse embryo 3T3 cell line as the immunogen.
Degré de pureté :Min. 95%ZFP36 antibody
The ZFP36 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as ZFP36. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and mRNA stability.ARL3 antibody
ARL3 antibody was raised in rabbit using the N terminal of ARL3 as the immunogen
Degré de pureté :Min. 95%Mycophenolic Acid antibody
Mycophenolic Acid antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to various proteins, including β-catenin, dopamine, TNF-α, tyrosine kinase receptors, phosphatases, and nuclear factors. This antibody exhibits cytotoxic activity against cells expressing these proteins and has been extensively used in studies involving antigen detection and antibody-drug conjugates. Mycophenolic Acid antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high specificity and affinity make it an essential component in many research applications.Degré de pureté :Min. 95%Goat anti Mouse IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.
Degré de pureté :Min. 95%IFN gamma antibody
IFN gamma antibody was raised in mouse using highly pure recombinant human IFN-gamma as the immunogen.TMCC1 antibody
TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK
Degré de pureté :Min. 95%Donkey anti Sheep IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.Degré de pureté :Min. 95%TMEM195 antibody
TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISL
Degré de pureté :Min. 95%CD11b antibody (Spectral Red)
CD11b antibody (Spectral Red) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.
Degré de pureté :Min. 95%Glycoprotein Ib antibody
Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Degré de pureté :Min. 95%Donkey anti Goat IgG (H + L)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Degré de pureté :Min. 95%EFNA4 antibody
The EFNA4 antibody is a monoclonal antibody that targets autoantibodies against the EFNA4 protein. This protein is involved in various biological processes, including cell adhesion and migration. The EFNA4 antibody can be used in research and diagnostic applications to detect the presence of autoantibodies in human serum.
SHP2 antibody
The SHP2 antibody is a monoclonal antibody that specifically targets SHP2, a protein involved in various cellular processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications.Degré de pureté :Min. 95%Tau antibody
The Tau antibody is a medicament that belongs to the class of globulin-based drugs. It is a polyclonal antibody that has been specifically designed to target and neutralize the activity of Tau protein. Tau protein plays a crucial role in the pathogenesis of neurodegenerative diseases, such as Alzheimer's disease, by forming abnormal aggregates in the brain.
Degré de pureté :Min. 95%IGFBP3 antibody
The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.
Degré de pureté :Min. 95%Lamin Type A and C antibody
Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.
Goat anti Human IgM (mu chain) (HRP)
This antibody reacts with heavy chains on human IgM (mu chain).Degré de pureté :Min. 95%DKK1 antibody
DKK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%p73 antibody
The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.
Degré de pureté :Min. 95%SLC27A2 antibody
SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Degré de pureté :Min. 95%ALDH3B1 antibody
ALDH3B1 antibody was raised using the N terminal of ALDH3B1 corresponding to a region with amino acids DPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQD
CD11b antibody (PE)
CD11b antibody (biotin) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.
Degré de pureté :Min. 95%
