Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
HIST2H2AA3 antibody
HIST2H2AA3 antibody was raised using the middle region of HIST2H2AA3 corresponding to a region with amino acids PRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Rabbit anti Dog IgG (H + L) (Alk Phos)
Rabbit anti-dog IgG (H+L) (Alk Phos) was raised in rabbit using canine IgG whole molecule as the immunogen.Degré de pureté :Min. 95%SFRP2 antibody
SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
Salmonella antibody
Salmonella antibody was raised in mouse using LPS of Salmonella typhimurium as the immunogen.SSH3 antibody
The SSH3 antibody is a highly specialized product in the field of Life Sciences. It is an amino-terminal activated antibody that is commonly used in research and diagnostic applications. This antibody specifically targets and binds to various proteins, such as annexin, chemokine, glucagon, and natriuretic peptides. The SSH3 antibody has been extensively tested and validated for its high specificity and sensitivity.
Phenobarbital antibody
Phenobarbital antibody was raised in mouse using phenobarbital-KLH conjugate as the immunogen.Degré de pureté :>95% By Sds-Page.Calponin 2 antibody
Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC
IKB alpha antibody
The IKB alpha antibody is a highly specialized monoclonal antibody that targets and binds to the inhibitor of kappa B alpha (IKBα) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It is widely used in research laboratories for the detection and analysis of IKBα in different biological samples.
Degré de pureté :Min. 95%NUP50 antibody
NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED
Goat anti Human IgG (H + L) (HRP)
Goat anti-human IgG (H + L) (HRP) was raised in goat using hamster IgG (H & L) as the immunogen.
CTNNB1 antibody
The CTNNB1 antibody is a monoclonal antibody that specifically targets the CTNNB1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion, signal transduction, and gene expression. The CTNNB1 antibody has been extensively studied and shown to be highly specific and sensitive in detecting CTNNB1 in various biological samples.
Factor X antibody
Factor X antibody was raised in sheep using purified mouse factor X as the immunogen.Degré de pureté :Min. 95%INSR antibody
The INSR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the insulin receptor (INSR) protein, which plays a crucial role in cellular signaling and glucose metabolism. This antibody can be used to study various aspects of INSR function, including its interaction with other proteins such as telomerase, glucagon, β-catenin, and collagen.
SMAD3 antibody
The SMAD3 antibody is a glycoprotein that acts as a growth factor and plays a crucial role in various cellular processes. It is a monoclonal antibody specifically designed to target SMAD3, which is involved in signal transduction pathways related to cell proliferation and differentiation. This antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry.
Degré de pureté :Min. 95%EphB1 antibody
EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.
CD160 antibody
The CD160 antibody is a monoclonal antibody that targets the CD160 protein, which is involved in immune response regulation. It acts as a colony-stimulating factor and plays a role in the activation of macrophages. The CD160 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various experimental models. It has been shown to inhibit the activity of phosphatase enzymes and interfere with interferon signaling pathways. Additionally, it has been found to bind to glutamate receptors and modulate their function. The CD160 antibody is highly specific and exhibits strong binding affinity to its target. It can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. This high-quality antibody is suitable for research purposes and is compatible with human serum samples.SOCS3 antibody
The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.ATP6V0D2 antibody
ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Myoglobin antibody
Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.SOX2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied and proven to have high human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
SLAMF7 antibody
The SLAMF7 antibody is a highly specialized biomolecule that acts as a growth factor and protein kinase. It is commonly used in Life Sciences research and has proven to be an invaluable tool for scientists in various fields. This monoclonal antibody specifically targets the interleukin-15 receptor, which plays a crucial role in immune response regulation.
