Anticorps primaires

TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ

Calreticulin antibody is a polyclonal antibody that acts as an inhibitor of growth factors. It specifically targets low-density lipoprotein receptors and alpha-synuclein, two molecules that play a crucial role in cellular growth and development. Additionally, this antibody has been shown to bind to epidermal growth factor and trastuzumab, both monoclonal antibodies used in cancer treatment. By binding to these molecules, the calreticulin antibody prevents their interaction with nucleotide molecules, inhibiting nuclear signaling and ultimately suppressing cell growth. Furthermore, it exhibits anti-HER2 activity by blocking the amino group of epidermal growth factor receptors. With its multifaceted mechanisms of action, the calreticulin antibody holds promise for various therapeutic applications.

FBXO7 antibody was raised in Rabbit using Human FBXO7 as the immunogen

JMJD6 antibody was raised in Rabbit using Human JMJD6 as the immunogen

Factor V antibody was raised in sheep using human factor V purified from plasma as the immunogen.

Affinity purified Rabbit polyclonal GRAP2 antibody

CARD14 antibody was raised in Rabbit using Human CARD14 as the immunogen

Purified Rabbit polyclonal MYB53 antibody

Rabbit polyclonal QARS antibody

The ND2 antibody is a highly specialized antibody that targets specific growth factors in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The ND2 antibody has been extensively studied for its ability to detect glycosylation patterns and identify key molecules involved in cellular processes.

Purified Polyclonal PLA2G4C antibody

GSDMD antibody was raised in Rabbit using Human GSDMD as the immunogen

PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.

SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen

Affinity purified Rabbit polyclonal GLIS1 antibody

Affinity purified Rabbit polyclonal PEX6 antibody

HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS

DDX27 antibody was raised using a synthetic peptide corresponding to a region with amino acids DEKIEKVRKKRKTEDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSE

Rabbit polyclonal WIPF2 antibody

Affinity purified Rabbit polyclonal ZFP 574 antibody

The Cystatin B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to Cystatin B, a fatty acid-binding protein involved in various cellular processes. This antibody is particularly useful for studying the role of Cystatin B in interferon-activated pathways, endocytic uptake mechanisms, and low-density lipoprotein metabolism.

Rabbit polyclonal IFNG antibody (biotin)

GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

Rabbit polyclonal OR4F4 antibody

Rat monoclonal CD4 antibody (biotin); mouse target; IgG2b kappa; clone GK1.5

Affinity purified Rabbit polyclonal NEK4 antibody

ARHGAP10 antibody was raised in Rabbit using Human ARHGAP10 as the immunogen

Affinity purified Rabbit polyclonal Flightless I antibody

Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Mesothelin antibody is a polyclonal antibody that specifically targets the mesothelin antigen. It is commonly used in Life Sciences research to study the role of mesothelin in various biological processes. Mesothelin is an epidermal growth factor (EGF)-like protein that is expressed on the surface of certain cells, including mesothelial cells and some cancer cells. The antibody binds to mesothelin and can be used for neutralizing or detecting its presence in samples. Additionally, this antibody has been shown to have cross-reactivity with other antigens such as vitronectin and glucagon. Researchers often use it alongside other antibodies, such as cetuximab, to investigate the interactions between these proteins and their potential therapeutic applications.

TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Additionally, this drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

Mouse RBC antibody (Texas Red) was raised in rabbit using mouse erythrocytes as the immunogen.

EIF2S3 antibody was raised in Rabbit using Human EIF2S3 as the immunogen

Affinity purified Rabbit polyclonal Myotubularin related protein 4 antibody

The FRK antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets erythropoietin and anti-VEGF, making it an essential tool for studying endothelial growth and antiangiogenic properties. The FRK antibody has been extensively tested and proven to be highly effective in inhibiting the growth factor responsible for angiogenesis. In addition, it has shown cytotoxic effects on cancer cells and has been used to assess microvessel density in tumor samples. This high-quality monoclonal antibody is a valuable asset for researchers and scientists working in the field of antibodies and natriuretic factors. Its colloidal nature ensures easy handling and accurate results, making it an indispensable tool for cutting-edge research in the Life Sciences field.

Affinity purified Rabbit polyclonal GPRC6A antibody

The WNT4 antibody is a highly specialized monoclonal antibody that targets the WNT4 protein, a growth factor involved in various cellular processes. This antibody is designed to specifically bind to WNT4 dimers, inhibiting their activity and preventing downstream signaling pathways.

The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The CDK2 antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and bind to cyclin-dependent kinase 2 (CDK2), an enzyme involved in cell cycle regulation. This antibody has been extensively validated for use in various assays, including Western blotting, immunohistochemistry, and immunofluorescence.

The CPVL antibody is a polyclonal antibody that is widely used in the field of life sciences. It specifically targets epidermal growth factor (EGF) and chemokine receptors, making it an essential tool for researchers studying these signaling pathways. In addition to its polyclonal form, monoclonal antibodies are also available for more specific applications.

GFRA4 antibody was raised in rabbit using the C terminal of GFRA4 as the immunogen

Affinity purified Rabbit polyclonal PCCB antibody