Anticorps primaires

Rabbit polyclonal NOC2 antibody

Mouse anti-Human Monoclonal CD16 antibody

Mouse monoclonal RPN1 antibody

Rabbit polyclonal OR9G4 antibody

ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

NAB1 antibody was raised in mouse using recombinant Human Ngfi-A Binding Protein 1 (Egr1 Binding Protein 1)

VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Rabbit polyclonal STATH antibody

SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.

Sheep polyclonal Azaperone antibody

FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids QKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRG

Rabbit polyclonal Casein kinase 2 antibody (HRP)

Rabbit polyclonal SEC22B antibody

Rabbit polyclonal UQCRFS1 antibody

FBXW11 antibody was raised in Rabbit using Human FBXW11 as the immunogen

Rabbit polyclonal EDG2 antibody

GBP1 antibody was raised in Rabbit using Human GBP1 as the immunogen

DNAL4 antibody was raised in Rabbit using Human DNAL4 as the immunogen

Rabbit polyclonal PLA2G4F antibody

Mouse monoclonal EPSP synthase antibody

Rabbit polyclonal OR2L5 antibody

Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Rabbit polyclonal RAD23B antibody

CFTR antibody is an antibody that specifically targets the cystic fibrosis transmembrane conductance regulator (CFTR) protein. CFTR is involved in the transport of chloride ions across cell membranes, and mutations in this protein can lead to cystic fibrosis. This antibody can be used in various Life Sciences applications, such as immunohistochemistry and Western blotting, to study the expression and localization of CFTR. It has been shown to bind to CFTR with high specificity and sensitivity. Additionally, this antibody has been used to investigate the role of CFTR in various biological processes, including collagen synthesis, hyaluronidase activity, and microvessel density regulation. Its ability to detect glycoproteins and growth factors makes it a valuable tool for studying cellular signaling pathways involving CFTR.

Rabbit polyclonal NNT antibody

Rabbit polyclonal 14-3-3 zeta/theta antibody

KIDINS220 antibody was raised in Rabbit using Human KIDINS220 as the immunogen

Purified Rabbit polyclonal MPHOSPH9 antibody

Rabbit polyclonal NFKB p105/p50 antibody (Ser927)

The CD100 antibody is a monoclonal antibody that targets the erythropoietin receptor. It has been widely used in the field of Life Sciences for various applications. This antibody specifically binds to the erythropoietin receptor, which plays a crucial role in red blood cell production and differentiation. By targeting this receptor, the CD100 antibody can modulate erythropoiesis and potentially have therapeutic effects on conditions related to red blood cell disorders.

Mouse monoclonal MGRN1 antibody

Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.

The FZD8 antibody is a diagnostic reagent that plays a crucial role in the field of Life Sciences. It is an antigen-specific antibody that specifically targets and binds to the FZD8 protein. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.

Rabbit polyclonal RAB1B antibody

The PPIA antibody is a monoclonal antibody that specifically targets the extracellular domain of the protein peptidylprolyl isomerase A (PPIA). PPIA is an enzyme that plays a crucial role in protein folding and is involved in various cellular processes, including interleukin signaling and antiviral defense. The PPIA antibody has been extensively studied and shown to have high affinity binding to PPIA, making it a valuable tool for research in the Life Sciences field.

LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

Goat anti-human lambda chain (Fab'2) was raised in goat using human l (lambda) light chain as the immunogen.

MTHFD2 antibody was raised in Rabbit using Human MTHFD2 as the immunogen

Collagen type II antibody was raised in mouse using purified preparation of lathritic type II collagen from embryonic chicken sternum as the immunogen.

PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN

The EFNA4 antibody is a monoclonal antibody that targets autoantibodies against the EFNA4 protein. This protein is involved in various biological processes, including cell adhesion and migration. The EFNA4 antibody can be used in research and diagnostic applications to detect the presence of autoantibodies in human serum.

CREM antibody was raised in Rabbit using Human CREM as the immunogen

MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Rabbit polyclonal SRP9 antibody

Rabbit monoclonal VEGF antibody (biotin)