Anticorps primaires

Guinea pig polyclonal Hemoglobin antibody (biotin)

HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN

GBP1 antibody was raised in Rabbit using Human GBP1 as the immunogen

The PNMT antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of the neurotransmitter norepinephrine.

PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Rabbit polyclonal ZFP36L2 antibody

Mouse monoclonal PDE2A antibody

Rabbit polyclonal ARAF antibody (Ser299)

The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.

Mouse monoclonal TPMT antibody

Rabbit polyclonal argF antibody (HRP)

MYST2 antibody was raised in Rabbit using Human MYST2 as the immunogen

C4orf15 antibody was raised in Rabbit using Human C4orf15 as the immunogen

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.

Rabbit polyclonal OR2L5 antibody

Mouse monoclonal NSMCE2 antibody

CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen

HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.

DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen

The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.

Rabbit polyclonal THOC6 antibody

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.

Rabbit polyclonal PRKAR2B antibody

Rabbit polyclonal TSR2 antibody

KCTD14 antibody was raised in Rabbit using Human KCTD14 as the immunogen

Rabbit polyclonal NUBP2 antibody

Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP

MCM2 antibody was raised in Rabbit using Human MCM2 as the immunogen

CD11b antibody (Spectral Red) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

The RAF1 antibody is a monoclonal antibody that specifically targets elastase, an enzyme involved in the breakdown of proteins. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody can be used to detect elastase levels in various biological samples, including human serum. Additionally, it has been shown to have potential therapeutic applications, such as inhibiting the action of elastase in conditions like pancreatitis or chronic obstructive pulmonary disease (COPD). The RAF1 antibody can also be used in combination with other antibodies, such as insulin or anti-VEGF antibodies, to study the interactions between different growth factors and signaling pathways. Its versatility and specificity make it a valuable tool for scientists and researchers working in diverse areas of biomedical research.

ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET

Rabbit polyclonal PLD1 antibody (Ser561)

Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.

WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen

The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.

Rabbit polyclonal TAGLN3 antibody

Mouse monoclonal NUDT6 antibody

Affinity purified Rabbit polyclonal Dbs antibody

Rabbit polyclonal Aquaporin 2 antibody (Ser256)

Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen

Rabbit polyclonal TADA3L antibody

The PCIP antibody is a highly specialized monoclonal antibody that targets the fas-mediated apoptosis pathway. It has been extensively studied in adipose tissue and has shown cytotoxic effects on cells expressing high levels of interleukin-6 (IL-6) and growth factor receptors. This monoclonal antibody specifically binds to β-catenin, a key protein involved in cell signaling and regulation of gene expression. It has also been shown to interact with other monoclonal antibodies targeting collagen, erythropoietin, fibrinogen, and phosphatase. The PCIP antibody disrupts the organization of actin filaments within cells, leading to apoptosis and inhibition of cell growth.

Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.