Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75448 produits trouvés pour "Anticorps primaires"
ATF3 antibody
The ATF3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing (TNF) monoclonal antibodies. It is commonly used in Life Sciences research as a tool to study the function and expression of ATF3, a transcription factor involved in cellular stress response. This monoclonal antibody specifically binds to human mitochondrial ATF3 and has been widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. The ATF3 antibody recognizes an antigen located on the surface of cells and can be utilized for both diagnostic and therapeutic purposes. With its high specificity and cytotoxic properties, this glycoprotein is an essential tool for researchers working in the field of molecular biology and immunology. Additionally, polyclonal antibodies targeting ATF3 are also available for those who require a broader range of reactivity.
PDIA4 antibody
The PDIA4 antibody is a powerful tool in the field of Life Sciences. It is designed to target and detect PDIA4, a protein that plays a crucial role in various cellular processes. PDIA4 is involved in oxidative damage repair, actin dynamics, autoantibody production, and the regulation of growth factors such as erythropoietin and epidermal growth factor.
AIMP1 antibody
The AIMP1 antibody is a monoclonal antibody that targets TNF-related apoptosis-inducing protein (TRAIL). It is commonly used in life sciences research and has applications in various fields. The AIMP1 antibody specifically binds to TNF-α, a cytokine involved in inflammation and cell death processes. By targeting TNF-α, the AIMP1 antibody can modulate apoptosis, making it a valuable tool for studying cell signaling pathways and exploring potential therapeutic interventions.
SSBP3 antibody
SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP
CAP1 antibody
The CAP1 antibody is a highly specialized monoclonal antibody that targets the fibronectin protein. It specifically recognizes and binds to specific amino acid residues on fibronectin, inhibiting its function. This antibody has been extensively studied in the field of Life Sciences and has shown remarkable pharmacokinetic properties.
ROR1 antibody
ROR1 antibody was raised in Mouse using recombinant extracellular fragment of human ROR1 (aa30-406) fused with hIgGFc tag, expressed in HEK293 cells as the immunogen.MCM2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Guinea Pig RBC antibody (Texas Red)
Guinea pig RBC antibody (Texas Red) was raised in rabbit using guinea pig erythrocytes as the immunogen.FAK antibody
The FAK antibody is a powerful tool in the field of Life Sciences. It is an antiviral antibody that specifically targets and neutralizes a cell antigen known as focal adhesion kinase (FAK). FAK is a key regulator of cell growth, migration, and survival, making it an important target for research and therapeutic applications.
CROT antibody
The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.
Lipase antibody (Pancreatic)
Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
TACC3 antibody
The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.
Chlamydia trachomatis antibody
Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis LPS as the immunogen.IL24 antibody
The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.
Giardia lamblia antibody
The Giardia lamblia antibody is a highly specialized product used in Life Sciences research. This antibody specifically targets the circumsporozoite protein found in Giardia lamblia, an intestinal parasite that causes giardiasis. The antibody is designed to bind to this protein and neutralize its activity.
CtBP1 antibody
The CtBP1 antibody is a highly specialized antibody that specifically targets and neutralizes CtBP1, a growth factor involved in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the function of CtBP1 in different biological systems.
Salmonella antibody
Salmonella antibody was raised in mouse using LPS of Salmonella typhimurium as the immunogen.
HSA antibody
The HSA antibody is a monoclonal antibody that is commonly used in steroid assays and other diagnostic tests involving human serum. It has been shown to have an inhibitory effect on the activity of certain antibodies, making it a valuable tool in research and medical settings. This specific monoclonal antibody has also been found to have anti-mesothelin properties, which makes it useful in the study and treatment of mesothelioma, a type of cancer. Additionally, the HSA antibody has demonstrated antioxidant activity and the ability to inhibit the growth factor in certain cell lines. Its versatility and wide range of applications make it an essential tool in the field of life sciences.
FAN antibody
The FAN antibody is a highly versatile and effective tool used in various assays and hybridization techniques. It is an isothiocyanate-conjugated monoclonal antibody that specifically targets alpha-fetoprotein (AFP). This antibody has been widely used in research and diagnostic applications for the detection and quantification of AFP in biological samples.
GST antibody
The GST antibody is a highly reactive and cytotoxic monoclonal antibody that is commonly used in Life Sciences research. It specifically targets the glutathione S-transferase (GST) protein, which plays a crucial role in detoxification processes within cells. The GST antibody can be used to detect and quantify GST levels in various samples, including human serum.VSIG4 antibody
VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
COX15 antibody
COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
IL23 antibody
IL23 antibody is an immunosuppressant that belongs to the class of monoclonal antibodies. It specifically targets IL-23, a cytokine involved in immune responses and inflammation. By binding to IL-23, this antibody prevents its interaction with its receptor, thereby inhibiting the downstream signaling pathways that lead to inflammation. IL23 antibody has been shown to effectively reduce the production of pro-inflammatory cytokines and inhibit the activation of immune cells. This antibody is commonly used in research and clinical settings to study the role of IL-23 in various diseases, including autoimmune disorders and cancer. Its high specificity and potency make it a valuable tool for investigating the therapeutic potential of targeting IL-23 in these conditions.
