Anticorps primaires

<p>Rabbit polyclonal KCNMB2 antibody</p>

<p>The GM2A antibody is a polyclonal antibody that has various applications in the field of Life Sciences. It can be used to detect and measure the levels of creatine kinase and phosphatase, which are important enzymes involved in cellular metabolism. Additionally, this antibody can be used for research involving mesenchymal stem cells, as it can help identify and characterize these cells. The GM2A antibody can also be used in electrode-based assays to study glucose-6-phosphate metabolism and collagen synthesis. In the medical field, this antibody has potential applications in diagnostics and therapeutics, particularly in the detection and treatment of diseases such as cancer. It has been shown to have binding affinity towards sorafenib, a drug used in the treatment of liver cancer. Furthermore, the GM2A antibody can be utilized to measure hepatocyte growth factor levels in human serum samples. Overall, this versatile antibody offers researchers and clinicians a valuable tool for studying various biological processes and developing innovative treatments.</p>

<p>The Cadherin 6 antibody is a monoclonal antibody that specifically targets the plasminogen receptor. It is commonly used in life sciences research for various applications. This antibody has high affinity and specificity for its target, making it an ideal tool for studying the function of Cadherin 6.</p>

<p>ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its potency has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>The CREB antibody is a highly effective tool for various applications in the field of Life Sciences. This polyclonal antibody is specifically designed to recognize and bind to the cAMP response element-binding protein (CREB), a transcription factor involved in regulating gene expression.</p>

<p>Purified Polyclonal IRAK2 antibody</p>

<p>The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.</p>

<p>The DOCK11 antibody is a growth factor that plays a crucial role in various processes within the Life Sciences field. It is an essential component in cell antigen recognition and the production of antibodies. The DOCK11 antibody has been shown to inhibit the activity of protons, which are responsible for acidification and cellular damage. Additionally, it has been found to have inhibitory effects on interleukin-6, a cytokine involved in inflammation and immune response regulation.</p>

<p>The p53 antibody is a highly specialized monoclonal antibody that specifically targets the nuclear protein p53. This antibody has been extensively validated for use in various research applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>The p70S6k antibody is an acidic monoclonal antibody that specifically targets the cysteine disulfide region of the p70S6k protein. It has been widely used in Life Sciences research to study the role of p70S6k in various cellular processes. This antibody has neutralizing activity against oncostatin and natriuretic factors, making it a valuable tool for investigating their signaling pathways. Additionally, the p70S6k antibody has been used as a blood biomarker for ultrasensitive detection of leukemia inhibitory factor in human serum samples. With its high affinity and specificity, this monoclonal antibody is an essential tool for researchers studying the primary amino acid sequence and structure of p70S6k using techniques such as electrode-based assays.</p>

<p>C6ORF182 antibody was raised using the middle region of C6Orf182 corresponding to a region with amino acids DIECELECLLKKMEIKGEQISKLKKHQDSVCKLQQKVQNSKMSEASGIQQ</p>

<p>CD16 antibody was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>SLC9A3R2 Monoclonal Antibody</p>

<p>Rabbit Polyclonal PKC mu antibody (Ser738)</p>

<p>Mouse monoclonal RANBP9 antibody</p>

<p>Collagen Type III antibody is a powerful growth factor that plays a crucial role in various biological processes. It has been shown to interact with interferon and other antibodies, making it an essential component in immunological research. This monoclonal antibody specifically targets collagen, a structural protein found in connective tissues, and can be used for various applications such as Western blotting, immunohistochemistry, and ELISA assays.</p>

<p>Ccdc90b antibody was raised in rabbit using the N terminal of Ccdc90b as the immunogen</p>

<p>Mouse monoclonal Pyruvate Dehydrogenase antibody (C-terminus)</p>

<p>ALAD antibody was raised using the middle region of ALAD corresponding to a region with amino acids SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD</p>

<p>Rabbit polyclonal WRN antibody (Ser1141)</p>

<p>The hnRNP L Antibody is a highly specific monoclonal antibody that is widely used in life sciences research. This cytotoxic antibody targets hnRNP L, a nuclear protein involved in various cellular processes such as RNA splicing, transport, and stability. The hnRNP L Antibody has been extensively validated for use in assays such as immunofluorescence, immunohistochemistry, and western blotting. It provides reliable and reproducible results, making it an essential tool for researchers studying the role of hnRNP L in gene expression regulation and other molecular mechanisms. With its high affinity and specificity, this monoclonal antibody offers exceptional sensitivity and accuracy in detecting hnRNP L in various biological samples. Whether you are investigating myostatin signaling pathways or exploring the functions of fibrinogen or lipoprotein lipase, the hnRNP L Antibody is an indispensable tool for your research needs. Trust this reliable antibody to provide accurate and consistent results that will advance your</p>

<p>DCUN1D4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>