Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
MCL1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.
IL6 antibody
IL6 antibody is a highly effective therapeutic agent that targets interleukin-6 (IL-6), a key cytokine involved in inflammatory responses. IL-6 plays a crucial role in various physiological processes, including immune response and inflammation. This antibody specifically binds to IL-6, preventing its interaction with its receptors and inhibiting downstream signaling pathways.
FZD6 antibody
The FZD6 antibody is a powerful diagnostic agent and inhibitor that belongs to the class of polyclonal antibodies. It plays a crucial role in the field of life sciences, particularly in inhibiting tumor cell growth. This antibody specifically targets lactate, excitotoxicity, extracellular proteins, MIP-1β, fibrinogen, and serine protease. Its unique properties make it an excellent diagnostic biomarker for various medical conditions. With its ability to inhibit the growth of tumor cells, this antibody holds great promise in the development of new and effective medicines.
PSMC4 antibody
The PSMC4 antibody is a highly specialized antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied for its potential applications in cancer research and therapy.
Factor VIII antibody (biotin)
Factor VIII antibody (biotin) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.RABGEF1 antibody
RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ
HAO1 antibody
The HAO1 antibody is a monoclonal antibody that specifically targets and binds to the HAO1 protein. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications.
LRRC57 antibody
LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI
NGAL antibody
The NGAL antibody is a powerful tool in the field of Life Sciences. It is an adeno-associated antibody that specifically targets and neutralizes the activity of tyrosine, TNF-α, and other activated molecules. This antibody has been extensively studied and proven to be highly effective in various research applications.
Lamin B2 antibody
The Lamin B2 antibody is a highly specialized antibody that targets the phosphorylation site on the lamin B2 protein. This antibody is widely used in Life Sciences research for its ability to detect and study the role of lamin B2 in various cellular processes. Lamin B2 is an important component of the nuclear lamina, which provides structural support to the nucleus and regulates gene expression. By targeting the phosphorylation site on lamin B2, this antibody allows researchers to investigate the impact of phosphorylation on lamin B2 function and its implications in immunomodulation, antinociceptive effects, and pluripotent stem cell differentiation. With its high specificity and sensitivity, this antibody is an essential tool for scientists working in fields such as cell biology, molecular biology, and immunology. Whether you are studying vaccine strains, developing new medicines, or exploring novel therapeutic strategies, the Lamin B2 antibody will be a valuable asset in your research.
WTAP antibody
The WTAP antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of Life Sciences. It acts as an inhibitory factor, blocking specific protein interactions and pathways. This antibody is produced using state-of-the-art technology and is free from any harmful excipients.
STT3B antibody
The STT3B antibody is a powerful tool in the field of Life Sciences. It is widely used in research and diagnostic applications due to its high specificity and sensitivity. This antibody has been extensively tested and proven to be effective in various experiments.
ARC antibody
The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.
SLC1A5 antibody
SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
TMPRSS6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it undergoes conversion into its active form. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. With its patch-clamp technique on human erythrocytes, this drug demonstrates high frequency of human activity.
MTRR antibody
MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
TALDO1 antibody
The TALDO1 antibody is a highly specialized protein that belongs to the group of polyclonal antibodies. It is used in life sciences research to detect and study transaldolase, an important enzyme involved in nucleic acid metabolism. This antibody specifically binds to TALDO1, making it a valuable tool for identifying and quantifying this biomarker in various biological samples. By targeting specific polypeptides, the TALDO1 antibody enables researchers to gain insights into the role of transaldolase in cellular processes and disease development. Its high specificity and sensitivity make it an essential component in many scientific experiments and studies.
TOPK antibody
The TOPK antibody is a monoclonal antibody that targets the T-LAK cell-originated protein kinase (TOPK). This antibody is widely used in Life Sciences research to study the role of TOPK in various cellular processes. It has been shown to interact with chemokines, interferons, and epidermal growth factors, suggesting its involvement in immune responses and cell signaling pathways. The TOPK antibody is highly specific and can be used for applications such as immunofluorescence, Western blotting, and immunoprecipitation. Its binding to TOPK effectively inhibits its kinase activity, making it a valuable tool for studying the function of this family kinase. The TOPK antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their experimental needs. Its high affinity for TOPK ensures reliable and accurate results in experiments. With its neutralizing properties, this antibody can help elucidate the molecular mechanisms underlying various diseases and aid in the
FASL antibody
The FASL antibody is a powerful tool in the field of Life Sciences. It is an amino group-containing antibody that specifically targets the HER2 protein, which is known to be involved in various cellular processes. One of the key functions of the FASL antibody is its ability to induce apoptosis through the FAS-mediated pathway. This means that it can trigger programmed cell death in cells that express high levels of HER2, making it a valuable tool for researchers studying cancer and other diseases.
MPT64 antibody
The MPT64 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain viruses and antibodies. It is commonly used in the field of Life Sciences for various applications. This antibody has been shown to have a strong affinity for interferon-gamma (IFN-gamma), a potent growth factor involved in immune response regulation. Additionally, it has the ability to bind to nuclear proteins and inhibit polymerase chain reactions (PCR). The MPT64 antibody can also be used to detect virus surface antigens in human serum samples, making it a valuable tool in diagnostic testing. With its electrode-activated properties, this antibody ensures accurate and reliable results in research and clinical settings.
Collagen Type VI Alpha 2 antibody
Collagen Type VI Alpha 2 antibody was raised using the C terminal of COL6A2 corresponding to a region with amino acids ARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAI
BMP6 antibody
The BMP6 antibody is a highly specialized collagen-based polyclonal antibody that targets the tyrosine residues in BMP6. This antibody is widely used in life sciences research to study the role of BMP6 in various biological processes. It has been shown to interact with multiple proteins, including plasminogen activator receptor, urokinase plasminogen activator, and alpha-fetoprotein. The BMP6 antibody is available as both a monoclonal and polyclonal antibody, offering researchers flexibility in their experimental design. This antibody has potential therapeutic applications, particularly in the treatment of thrombocytopenia and as a growth factor for tissue repair. Additionally, it has been found to have interactions with hyaluronic acid, further expanding its potential applications in regenerative medicine.
