Anticorps primaires

SH3RF1 antibody was raised using the middle region of SH3RF1 corresponding to a region with amino acids LLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHG

DSG3 antibody was raised in rabbit using the C terminal of DSG3 as the immunogen

Rat monoclonal B7DC antibody (biotin)

The GFAP antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in various life sciences applications, including immunoassays and protein detection. This antibody can be used to detect and quantify GFAP levels in various samples, such as human serum or tissue lysates. The GFAP antibody has been shown to inhibit the activity of phosphatase enzymes that are involved in signal transduction pathways. It is also conjugated to magnetic particles, allowing for easy purification and separation of the target molecule. Additionally, this antibody has been found to react with actin filaments, providing valuable insights into cellular structure and function. With its high specificity and sensitivity, the GFAP antibody is an essential tool for researchers studying glial cells and their role in various physiological processes.

The TH antibody is a neuroprotective antibody that targets tyrosine hydroxylase (TH), an enzyme involved in the synthesis of dopamine. It specifically recognizes and binds to various isoforms of 14-3-3 proteins when they are activated. This antibody has been extensively used in Life Sciences research for its ability to detect and quantify TH levels in different tissues and cell types.

Purified Polyclonal TAC1 antibody

CEP68 antibody was raised in Rabbit using Human CEP68 as the immunogen

Rabbit polyclonal DOK7 antibody

Affinity purified Rabbit polyclonal MPI antibody

HIST3H2A antibody was raised in Rabbit using Human HIST3H2A as the immunogen

Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.

CD38 antibody (PE) was raised in rat using CD38 as the immunogen.

Rabbit polyclonal USP12 antibody

CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.

The GSK3B antibody is a highly specific and potent monoclonal antibody that targets the fms-like tyrosine kinase 3 beta (GSK3B). It is designed to neutralize the activity of GSK3B, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the function of GSK3B.

GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE

Desmoglein 2 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to bind to desmoglein 2, a protein that plays a critical role in cell-cell adhesion in epithelial tissues. This antibody can be immobilized on an electrode surface for use in biosensor applications or used in immunohistochemistry and Western blotting techniques.

Mouse monoclonal Dengue NS1 antibody (Subtype 4). Supplied in PBS buffer with sodium azide

Rabbit polyclonal PEX1 antibody

Mouse monoclonal CD38 antibody (FITC)

CD152 antibody (biotin) was raised in hamster using murine CD152/CTLA-4 as the immunogen.

Rabbit polyclonal CSTF1 antibody

CD117 antibody (Spectral Red) was raised in rat using murine CD117/c-Kit as the immunogen.

Rabbit polyclonal Tau antibody (Ser422)

BRUNOL6 antibody was raised in Rabbit using Human BRUNOL6 as the immunogen

GMFB antibody was raised in Rabbit using Human GMFB as the immunogen

Rabbit polyclonal argF antibody (HRP)

Rabbit polyclonal STAT1 antibody (Ser727)

FKBP7 antibody was raised in Rabbit using Human FKBP7 as the immunogen

HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

NRG1 antibody was raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS

Mouse monoclonal HMOX2 antibody

ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA

The VEGFC antibody is a monoclonal antibody that targets and neutralizes the activity of Vascular Endothelial Growth Factor C (VEGFC). This antibody plays a crucial role in inhibiting the activation of TNF-α, leukemia inhibitory factor, and other oncogenic kinases. By binding to VEGFC, this antibody prevents its interaction with its receptors, thereby inhibiting the signaling pathways involved in angiogenesis and lymphangiogenesis.

The TST antibody is a polyclonal antibody that has been developed as an anti-connexin agent. It is designed to target connexins, which are proteins involved in cell communication. This antibody has been extensively tested and shown to be highly effective in neutralizing connexin activity.

GHRL antibody was raised in Rabbit using Human GHRL as the immunogen

The PSAT1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the PSAT1 protein, which plays a crucial role in cellular metabolism and growth regulation. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).

The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.

EML1 antibody was raised in Rabbit using Human EML1 as the immunogen

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.