Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
CHRNA5 antibody
CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
TMEM59L antibody
TMEM59L antibody was raised using the N terminal of TMEM59L corresponding to a region with amino acids PAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR
SOX13 antibody
The SOX13 antibody is a highly specialized monoclonal antibody that targets the SOX13 protein. This protein is involved in various cellular processes, including nephrotoxicity, fibrinogen production, and regulation of endogenous hematopoietic stem cells. The SOX13 antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of this protein.
FICD antibody
FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY
GFAP antibody
The GFAP antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in various life sciences applications, including immunoassays and protein detection. This antibody can be used to detect and quantify GFAP levels in various samples, such as human serum or tissue lysates. The GFAP antibody has been shown to inhibit the activity of phosphatase enzymes that are involved in signal transduction pathways. It is also conjugated to magnetic particles, allowing for easy purification and separation of the target molecule. Additionally, this antibody has been found to react with actin filaments, providing valuable insights into cellular structure and function. With its high specificity and sensitivity, the GFAP antibody is an essential tool for researchers studying glial cells and their role in various physiological processes.
Aromatase antibody
The Aromatase antibody is a protein that belongs to the group of Polyclonal Antibodies. It plays a crucial role in the process of glycosylation, which is important for the proper functioning of various biological processes. This antibody can bind to specific targets and help in the detection and analysis of glycoproteins. Additionally, it has been shown to have cholinergic and acetyltransferase activities, making it valuable in research related to neurotransmission and signal transduction. The Aromatase antibody can also be used to detect autoantibodies and phosphatases in biological samples. Furthermore, studies have indicated its involvement in regulating interleukin-6 levels, suggesting its potential role in modulating immune responses. Overall, this monoclonal antibody is an essential tool for researchers in Life Sciences and offers insights into various cellular processes, including genotoxicity and interferon signaling pathways.
C14ORF21 antibody
C14ORF21 antibody was raised using the middle region of C14Orf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF
RIPK4 antibody
RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN
EGF antibody
The EGF antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF), a key regulator of cell growth and division. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of EGF and its downstream signaling pathways.
BCOR antibody
The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
ADAMTS4 antibody
The ADAMTS4 antibody is a highly specialized protein that has cytotoxic properties and promotes the growth of keratinocytes and endothelial cells. It is commonly used in research and medical applications to study the function of ADAMTS4, a protein involved in various cellular processes. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of certain cells. Additionally, it has been shown to have neutralizing effects on other proteins such as anti-CD33 antibody, growth factors, and family kinase inhibitors. The ADAMTS4 antibody is a valuable tool for scientists and researchers working in fields such as immunology, oncology, and cell biology.
CLCA1 antibody
The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.
THC antibody
The THC antibody is a highly specific monoclonal antibody that is used for the detection of delta-9-tetrahydrocannabinol (THC). It is derived from hybridoma cells and has been extensively tested for its accuracy and reliability. The antibody is buffered and can be used with human serum samples.eNOS antibody
The eNOS antibody is a powerful tool used in the field of Life Sciences. It is designed to target and detect endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.
CtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
FGF9 antibody
The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.
COX2 antibody
The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.
CHAT antibody
The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.
