Anticorps primaires

CD79b antibody (PE) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.

ERBB2 antibody was raised in Mouse using a purified recombinant fragment of human ERBB2 (aa750-987) expressed in E. coli as the immunogen.

AKR1C3 antibody was raised in Rabbit using Human AKR1C3 as the immunogen

Affinity purified Rabbit polyclonal ADCK4 antibody

Affinity purified Rabbit polyclonal NT5C2 antibody

ICAM1 antibody was raised in rabbit using highly pure recombinant human ICAM-1 as the immunogen.

Affinity purified Rabbit polyclonal HSD17B4 antibody

The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.

The beta Tubulin antibody is a highly specialized antibody that targets the beta tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes. The beta Tubulin antibody has been extensively studied and proven to be effective in detecting and quantifying beta tubulin in various biological samples.

Rabbit polyclonal BUD31 antibody

The Lin28B antibody is an effective molecular inhibitor that has shown promising results as an anticancer agent. It specifically targets the Lin28B protein, a key regulator of cancer progression. By inhibiting the activity of this protein, the antibody can effectively inhibit tumor growth and metastasis. This antibody is a valuable tool in cancer research and can be used in various applications such as chemotherapy and molecular biology studies. With its high specificity and potency, the Lin28B antibody offers great potential for developing novel therapeutic strategies against cancer.

STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)

The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.

Rabbit polyclonal MARCHVIII antibody

The Caveolin 1 antibody is a highly specialized monoclonal antibody that targets tyrosine residues on the Caveolin 1 protein. This protein plays a crucial role in cellular processes such as growth factor signaling and receptor internalization. By binding to Caveolin 1, this antibody inhibits its function, leading to cytotoxic effects on cancer cells.

Troponin I antibody (cardiac) was raised in mouse using amino acid residues 83-93 of cTnI as the immunogen.

CD45RC antibody (biotin) was raised in rat using an exon C-depentent epitope of the CD45 glycoprotein as the immunogen.

SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

CD45RB antibody (FITC) was raised in rat using cloned mouse Th2 cell lines as the immunogen.

LAG3 antibody was raised in Rabbit using Human LAG3 as the immunogen

Purified Rabbit polyclonal RACK1A antibody

ACOX2 antibody was raised in Rabbit using Human ACOX2 as the immunogen

Rabbit polyclonal NKX31 antibody

Rabbit polyclonal RECK antibody

TST antibody is a polypeptide expression of autoantibodies that specifically target the protein kinase. This antibody is widely used in Life Sciences research to study the role of protein kinases in various cellular processes. It has been shown to be effective in detecting and quantifying protein kinase activity in microvessel endothelial cells. TST antibody can also be used as a recombinant antigen for biochemical assays and interferon detection. Additionally, it has been utilized to investigate collagen-related diseases and evaluate the effects of inhibitors on protein kinase activity. With its versatility and specificity, TST antibody is an essential tool for researchers studying a wide range of biological processes, including non-alcoholic steatohepatitis and food extract analysis.

The LIMK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the LIMK1 protein, which plays a crucial role in cellular processes such as cell migration and cytoskeletal organization. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.

FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Rabbit polyclonal RPS6KB2 antibody

The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.

Affinity purified Rabbit polyclonal RASSF2 antibody

ApoB antibody was raised in mouse using human serum LDL as the immunogen.

GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL

The ORM2 antibody is a highly specialized monoclonal antibody that is used in various applications within the field of life sciences. This antibody specifically targets and reacts with the ORM2 protein, which is found in blood plasma and plays a crucial role in transporting fatty acids. The ORM2 antibody can be used in assays such as double-label immunofluorescence to detect the presence and localization of ORM2 protein in different cell types or tissues. It has also been utilized in studies involving pluripotent stem cells, where it helps identify specific markers such as neuronspecific enolase. With its high specificity and affinity, the ORM2 antibody provides researchers with a valuable tool for investigating the functions and interactions of this important protein.

MRPS27 antibody was raised in Rabbit using Human MRPS27 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

The CYP2D6 antibody is a polyclonal antibody that specifically targets the CYP2D6 enzyme. This enzyme is responsible for metabolizing a wide range of drugs, including bufuralol and interferon. The CYP2D6 antibody recognizes immunodominant epitopes on the enzyme and can be used in various research applications.

The SERPINF2 antibody is a highly effective neutralizing agent that has been extensively studied in various scientific fields, including Life Sciences. It is a monoclonal antibody that has shown promising results in inhibiting the activity of SERPINF2, a protein involved in adipose tissue regulation. Through electrochemical impedance spectroscopy, it has been demonstrated that this antibody effectively binds to SERPINF2 and prevents its interaction with other molecules in the reaction solution.

NRG1 antibody was raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS

The ACSS2 antibody is a highly specific monoclonal antibody that has been developed for use in various applications within the Life Sciences field. This antibody is designed to target and bind to ACSS2, an enzyme involved in cellular metabolism. By specifically targeting ACSS2, this antibody can be used to study the role of this enzyme in various cellular processes.

The ELK1 antibody is a highly specific polyclonal antibody that targets the subtilisin/kexin type of enzymes. It is capable of recognizing and binding to the activated form of ELK1, a transcription factor involved in hepatocyte growth. This monoclonal antibody has been extensively used in various life sciences research applications, particularly in the study of mesenchymal stem cells.

CD11c antibody (FITC) was raised in Mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.

FARS2 antibody was raised in Rabbit using Human FARS2 as the immunogen

Rabbit polyclonal SFRS5 antibody

Phosphotyrosine antibody was raised in rabbit using Iodoacetylphosphotyrosine-KLH conjugate as the immunogen.