Anticorps primaires

The Cofilin antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing chemokines, interferons, and growth factors that are activated and reactive in the body. This antibody has been shown to inhibit the activity of 3-kinase enzymes, which play a crucial role in cell growth and proliferation. Additionally, it can also bind to autoantibodies and taxol, preventing their harmful effects on the body. The Cofilin antibody has been extensively studied for its potential therapeutic applications in various diseases and conditions.

LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Rabbit polyclonal PRKCD antibody

Mouse monoclonal Episialin antibody

Affinity purified Rabbit polyclonal CHMP5 antibody

Mouse monoclonal MTFMT antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.