Anticorps primaires

The Nkx2.5 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the Nkx2.5 protein, which plays a crucial role in heart development and function. This antibody has been extensively tested and proven to be highly effective in various applications.

Rabbit polyclonal Ferritin heavy chain antibody (FITC)

Affinity purified Rabbit polyclonal Calpain 5 antibody

Affinity purified Rabbit polyclonal RPS10 antibody

TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.

The Bcl-2 antibody is a powerful tool in the field of immunology. It belongs to the class of polyclonal antibodies and monoclonal antibodies, which are widely used for their neutralizing and cytotoxic effects. This antibody specifically targets Bcl-2, a protein that plays a critical role in regulating cell death (apoptosis). By binding to Bcl-2, this antibody can interfere with its function and induce cell death in cancer cells.

Affinity purified Rabbit polyclonal IBSP antibody

BIN3 antibody was raised in Rabbit using Human BIN3 as the immunogen

Rabbit polyclonal PCYT1B antibody

The IBA1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the ionized calcium-binding adapter molecule 1 (IBA1) protein, which is primarily expressed in mouse peritoneal macrophages. This antibody is commonly used for immunohistochemistry and immunofluorescence experiments to visualize and study the activation and behavior of macrophages in various tissues.

Rabbit polyclonal PRKDC antibody

CDC42EP4 antibody was raised in Rabbit using Human CDC42EP4 as the immunogen

Affinity purified Rabbit polyclonal C9orf98 antibody

Goat anti-rat IgM (Alk Phos) was raised in goat using rat IgM mu chain as the immunogen.

Rabbit polyclonal UBL4B antibody

Rabbit polyclonal RGAP1 antibody

The TAP antibody is a polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and neutralize the growth factor interleukin-6 (IL-6). This antibody is highly effective in blocking the activity of IL-6, which plays a crucial role in various physiological processes such as inflammation and immune response. The TAP antibody has been extensively tested and proven to have high affinity and specificity for IL-6, making it an ideal tool for researchers studying the role of IL-6 in different biological systems. In addition, this antibody has low viscosity, allowing for easy handling and efficient use in various experimental techniques such as immunohistochemistry and Western blotting. Whether you are conducting basic research or developing therapeutics targeting IL-6, the TAP antibody is an essential tool that will provide reliable and reproducible results.

Mouse monoclonal gp130 antibody (biotin)

Affinity purified Rabbit polyclonal BZW2 antibody

CD30 antibody (biotin) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.

HNRPDL antibody was raised in Rabbit using Human HNRPDL as the immunogen

The NKG2D antibody is a highly specialized antibody that targets the vasoactive intestinal peptide. It belongs to the class of polyclonal antibodies and exhibits cytotoxic effects. This monoclonal antibody is designed to specifically bind to autoantibodies, preventing their harmful effects on the body. With its unique structure and composition of lysine and acid residues, this antibody has the ability to induce lysis of targeted cells. Its multidrug properties make it highly effective in combating various diseases and conditions. The NKG2D antibody is activated upon binding to necrosis factor-related apoptosis-inducing markers, leading to targeted cell death. Its nuclear-specific targeting makes it a valuable tool in research and diagnostics. With its multispecific nature, this monoclonal antibody offers a versatile solution for a wide range of applications.

CD26 antibody (biotin) was raised in mouse using human T cell clone as the immunogen.

Affinity purified Rabbit polyclonal Proteasome 20S alpha 7 antibody

Affinity purified Rabbit polyclonal GBP3 antibody

Rat monoclonal CD2 antibody (FITC)

The IL1b antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to interleukin 1 beta (IL-1β), a glycosylated glycoprotein involved in inflammatory responses. This antibody is widely used in studies related to autoimmune diseases, cancer, and immune system disorders.

Affinity purified Rabbit polyclonal PRPF39 antibody

Mouse monoclonal HLADQ antibody

IVD antibody is a reactive growth factor that belongs to the class of monoclonal antibodies. It specifically targets cysteine-rich proteins and can be used to detect autoantibodies in various assays. The IVD antibody has high affinity for tumor necrosis factor-alpha (TNF-α), a glycoprotein involved in inflammation and immune response. This antibody can be used in immunohistochemistry, Western blotting, and other techniques such as electrophoresis to study protein expression and localization. Additionally, the IVD antibody has been shown to modulate transmembrane conductance and act as an angiogenic inducer by targeting chemokines and activated cells. Overall, this versatile monoclonal antibody offers a valuable tool for researchers studying various biological processes and diseases.

LIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG

Affinity purified Rabbit polyclonal IL22 Receptor alpha 2 antibody

The PSMC4 antibody is a highly specialized antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied for its potential applications in cancer research and therapy.

Affinity purified Sheep polyclonal BSA antibody (HRP)

Rabbit polyclonal S6K alpha 6 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.