Anticorps primaires

EIF4EBP2 antibody was raised in Rabbit using Human EIF4EBP2 as the immunogen

The SLC6A1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It has been specifically designed to target and bind to the SLC6A1 protein, also known as the glycine transporter 1. This protein plays a crucial role in the transport of glycine, an important neurotransmitter involved in synaptic signaling.

The RPB8 antibody is an acidic monoclonal antibody that belongs to the colony-stimulating factor family. It is widely used in life sciences research for its ability to specifically bind to RPB8, a subunit of RNA polymerase II. This antibody has been shown to have toxic effects on cancer cells and can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The RPB8 antibody can also be used in combination with other antibodies, such as alpha-fetoprotein or vasoactive intestinal peptide, to study their interactions and signaling pathways. Additionally, this antibody has been shown to modulate the activity of phosphatases and interferons, making it a valuable tool for studying cellular processes and immune responses.

Cytokeratin 8 antibody is a neutralizing monoclonal antibody that targets collagen. It is used in Life Sciences research to study the role of cytokeratin 8 in various cellular processes. This antibody can specifically bind to cytokeratin 8, which is an intermediate filament protein found in epithelial cells. By targeting cytokeratin 8, this antibody can help researchers investigate its interactions with other proteins such as e-cadherin and β-catenin, as well as its involvement in signaling pathways mediated by growth factors like epidermal growth factor and TGF-beta. Additionally, the use of this antibody has been shown to correlate with changes in microvessel density and activation of certain cellular processes. With its high specificity and affinity for cytokeratin 8, this antibody is a valuable tool for studying the biology of epithelial cells and their associated diseases.

Affinity purified Rabbit polyclonal PEX13 antibody

FAM3C antibody was raised in Rabbit using Human FAM3C as the immunogen

Rabbit polyclonal GABRB2 antibody

CHDH antibody was raised in Rabbit using Human CHDH as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits strong bactericidal activity. It works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

The GRB2 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It has been developed to target and bind specifically to the GRB2 protein, which plays a crucial role in cell signaling pathways. This antibody can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

Rabbit polyclonal ZNF225 antibody

ABCF2 antibody was raised in Rabbit using Human ABCF2 as the immunogen

The Caspase 8 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It plays a crucial role in various biological processes, including natriuretic regulation, growth factor signaling, and medicament development. This antibody specifically targets caspase 8, an enzyme involved in cellular apoptosis.

Affinity purified Mouse polyclonal EPHA1 antibody

Affinity purified Rabbit polyclonal GRASP1 antibody

ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN

NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Rabbit polyclonal PAK1/3 antibody (Thr402)

Affinity purified Rabbit polyclonal HPS6 antibody

Affinity purified Rabbit polyclonal LOC80129 antibody

CKB antibody was raised in Rabbit using Human CKB as the immunogen

The p63 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the amino-terminal region of the p63 protein, which plays a crucial role in the development and function of cardiomyocytes. This antibody has been shown to be effective in detecting and quantifying levels of p63 in various biological samples, including pleural fluid and tissue samples.

Affinity purified Rabbit polyclonal C11orf2 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.

NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen

Rabbit polyclonal PITPNM1 antibody

The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Additionally, it has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

NDOR1 antibody was raised in Rabbit using Human NDOR1 as the immunogen

The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.

ATP1B1 antibody was raised in Rabbit using Human ATP1B1 as the immunogen

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

Purified Polyclonal Profilin 2 antibody

ITGA3 antibody was raised in Rabbit using Human ITGA3 as the immunogen

LDHAL6A antibody was raised in Rabbit using Human LDHAL6A as the immunogen

Affinity purified Rabbit polyclonal GPR137B antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.