Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
Eotaxin 3 antibody (biotin)
Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.
Phosphotyrosine antibody
The Phosphotyrosine antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically recognize and bind to phosphorylated tyrosine residues on proteins, making it an essential tool for studying kinase substrates and phosphatase activity. This antibody is particularly useful in investigating signaling pathways involving tyrosine kinase receptors, such as the epidermal growth factor receptor or colony-stimulating factor receptor.
Degré de pureté :Min. 95%HDAC4 antibody
The HDAC4 antibody is a highly specific antibody that targets the histone deacetylase 4 (HDAC4) protein. HDAC4 is involved in the regulation of gene expression and plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. This antibody can be used for research purposes in the field of Life Sciences to study the function and localization of HDAC4 in different cell types.
Degré de pureté :Min. 95%RAP1GDS1 antibody
The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.
TNFSF10 antibody
TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen
BRCA2 antibody
The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.
CD56 antibody (FITC)
CD56 antibody (FITC) was raised in mouse using human CD56 as the immunogen.
Degré de pureté :Min. 95%CD62L antibody (Allophycocyanin-CY7)
CD62L antibody (Allophycocyanin-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.
Degré de pureté :Min. 95%Protein S antibody
Protein S antibody is a highly specialized product in the field of Life Sciences. It is used for various applications such as particle chemiluminescence and polymerase chain reactions. This antibody is specifically designed to neutralize autoantibodies against human protein S, which plays a crucial role in the coagulation process. By targeting these autoantibodies, Protein S antibody enables accurate immunoassays and antigen-antibody reactions in research and diagnostic settings.
HSV1 gD antibody
HSV1 gD antibody was raised in mouse using herpes simplex I and II-infected cells as the immunogen.PDE3A antibody
PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%MIF antibody
The MIF antibody is a potent neutralizing agent that targets the growth factor and chemokine known as Macrophage Migration Inhibitory Factor (MIF). This polyclonal antibody binds to MIF, preventing its interaction with other molecules and inhibiting its biological activity. By blocking the action of MIF, this antibody can modulate immune responses, including the production of interferon and colony-stimulating factors. Additionally, it has antiviral properties and may play a role in regulating cell adhesion through interactions with E-cadherin. With its high specificity and effectiveness, the MIF antibody is a valuable tool for researchers studying immune responses and inflammatory diseases.
KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
Horse RBC antibody
Horse RBC antibody was raised in rabbit using equine erythrocytes as the immunogen.Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
