Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75560 produits trouvés pour "Anticorps primaires"
CD62E antibody (PE)
CD62E antibody (PE) was raised in mouse using human CD62E/E-selectin as the immunogen.
Degré de pureté :Min. 95%NR4A1 antibody
NR4A1 antibody was raised using the middle region of NR4A1 corresponding to a region with amino acids FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL
Murine Anti-HIV-1 p24 monoclonal Antibody
Please enquire for more information about Murine Anti-HIV-1 p24 monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
HIV1 gp120 antibody
HIV1 gp120 antibody was raised in rabbit using HIV-1 gp120 as the immunogen.Degré de pureté :Min. 95%Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(c) fragment as the immunogen.
Degré de pureté :Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
