Anticorps primaires

The Spermidine synthase antibody is a monoclonal antibody that specifically targets the tyrosine residue in interleukin-6 (IL-6). It is a highly specific and sensitive tool used in Life Sciences research to detect and quantify IL-6 levels in various biological samples. This antibody has been extensively validated for its specificity, sensitivity, and reproducibility.

ENO1 antibody was raised in Rabbit using Human ENO1 as the immunogen

CAT antibody was raised in Rabbit using Human CAT as the immunogen

The RGS4 antibody is a polyclonal antibody that targets the growth factor receptor. It specifically binds to the activated form of epidermal growth factor (EGF) and inhibits its signaling pathway. This antibody has been widely used in life sciences research to study the role of EGF in various cellular processes, including cell proliferation, migration, and differentiation. Additionally, the RGS4 antibody has shown cytotoxic effects on cancer cells expressing high levels of c-myc and HER2/neu receptors. It can be used in combination with other antibodies such as trastuzumab to enhance their efficacy. The high viscosity of this antibody solution allows for easy handling and ensures consistent results. Overall, the RGS4 antibody is a valuable tool for researchers studying growth factor signaling pathways and their role in disease progression.

The PCAF antibody is a monoclonal antibody that specifically targets the amino-terminal region of the PCAF protein. This antibody has been extensively studied and has shown promising results in various applications. It has been found to have neutralizing activity against TNF-α, a key cytokine involved in inflammatory processes. Additionally, the PCAF antibody has been shown to inhibit the formation of dimers of chemokine receptors, which are important for cell migration and activation.

SLC25A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS

Affinity purified Rabbit polyclonal ILBP antibody

The Aminoacylase 1 antibody is a highly active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody has been shown to activate oxygen uptake and is commonly used in the field of medicine. It serves as a serum marker and is particularly effective in high-flux assays. The Aminoacylase 1 antibody can also be used in conjunction with other antibodies such as anti-mesothelin or interferon-stimulated gene antibodies. Additionally, it has been found to have methyl transferase properties. With its wide range of applications, this antibody is an invaluable tool for researchers in various scientific disciplines.

Affinity purified Rabbit polyclonal PON2 antibody

CD5 antibody (FITC) was raised in mouse using feline CD5 as the immunogen.

Brachyury antibody was raised in rabbit using the internal sequence of the human Brachyury protein as the immunogen.

GMFB antibody was raised in Rabbit using Human GMFB as the immunogen

The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and detects tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The Tyrosine Hydroxylase antibody recognizes an epitope located within the protein sequence of tyrosine hydroxylase, allowing for precise and accurate detection.

Mouse monoclonal ACOT12 antibody

Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.

The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.

MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST

Affinity purified Rabbit polyclonal SHARP2 antibody

Mouse monoclonal KATNB1 antibody

Rabbit polyclonal UCHL1 antibody (biotin)

Rabbit polyclonal TRIP4 antibody

Rat monoclonal CD9 antibody (FITC)

The FZD6 antibody is a powerful diagnostic agent and inhibitor that belongs to the class of polyclonal antibodies. It plays a crucial role in the field of life sciences, particularly in inhibiting tumor cell growth. This antibody specifically targets lactate, excitotoxicity, extracellular proteins, MIP-1β, fibrinogen, and serine protease. Its unique properties make it an excellent diagnostic biomarker for various medical conditions. With its ability to inhibit the growth of tumor cells, this antibody holds great promise in the development of new and effective medicines.

Keratin K27 antibody was raised in Guinea Pig using synthetic peptide of human keratin K27 coupled to KLH as the immunogen.

Affinity purified Rabbit polyclonal NNT1 antibody

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

The MHC Class I antibody is a potent mitogen that belongs to the group of monoclonal antibodies. It has been extensively studied in the field of Life Sciences for its cytotoxic and growth factor properties. This antibody specifically targets and activates MHC Class I molecules, which are essential for immune recognition and response. Additionally, it has been shown to play a role in collagen immobilization and neutralizing oncolytic adenovirus. With its ability to modulate dopamine and mitogen-activated protein signaling pathways, the MHC Class I antibody is a valuable tool for research in various areas of biology and medicine.

Affinity purified Rabbit polyclonal CYFIP2 antibody

Affinity purified Rabbit polyclonal DUSP7 antibody

Rabbit polyclonal PSMB5 antibody

The GBA antibody is a polyclonal antibody that specifically targets the primary amino acid sequence of the glucocerebrosidase (GBA) enzyme. This antibody is derived from human serum and has been extensively validated for its specificity and sensitivity. It can be used in various applications, including enzyme-linked immunosorbent assays (ELISAs), Western blotting, and immunohistochemistry.

Rabbit polyclonal OR2L5 antibody

Affinity purified Rabbit polyclonal AMPK gamma 2 antibody

CD32 antibody (Fab'2) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.

HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI

Affinity purified Rabbit polyclonal LOC169436 antibody

NHP2 antibody was raised in Rabbit using Human NHP2 as the immunogen

The STOML1 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor. It specifically binds to the histidine residues on the receptor, blocking its activation and inhibiting downstream signaling pathways. This antibody has been extensively studied in Life Sciences research and has shown promising results in various applications.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.