Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75448 produits trouvés pour "Anticorps primaires"
HSPB8 antibody
HSPB8 antibody was raised using the middle region of HSPB8 corresponding to a region with amino acids PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA
PCBP2 antibody
The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.
MAP2K2 antibody
MAP2K2 antibody was raised using the N terminal of MAP2K2 corresponding to a region with amino acids LARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQK
LRRC14 antibody
LRRC14 antibody was raised in rabbit using the C terminal of LRRC14 as the immunogenDegré de pureté :Min. 95%JNK1 antibody
The JNK1 antibody is a highly specialized product used in Life Sciences research. It is designed to neutralize the activity of the growth factor, interleukin-6, in human serum. This antibody specifically targets and binds to the dimers of interleukin-6, preventing their interaction with cell receptors and inhibiting downstream signaling pathways.
Parathyroid Hormone antibody
The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.
PRLR antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, as it exhibits strong bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been demonstrated through the use of advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth. Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment against tuberculosis.Degré de pureté :Min. 95%BHMT antibody
The BHMT antibody is a monoclonal antibody that targets the cation channel inhibitors. It is used to detect autoantibodies against octanoyltransferase, which is an enzyme involved in the metabolism of carnitine. BHMT antibody can be used as part of diagnostic tests to identify individuals with deficiencies in this enzyme or those who may benefit from targeted therapies. This antibody is also commonly used in research settings to study the role of cation channels and methyl transferases in various diseases and conditions. With its high specificity and sensitivity, the BHMT antibody is a valuable tool for scientists and healthcare professionals alike.
CD62P antibody
The CD62P antibody is a monoclonal antibody that acts as an inhibitor. It has been shown to prevent hemolysis and inhibit the growth factor in adipose tissue. Additionally, this antibody has demonstrated potential in reducing amyloid plaque formation and targeting activated proteins. It also exhibits cytotoxic effects on Mycoplasma genitalium. The CD62P antibody belongs to the group of Monoclonal Antibodies and is effective against autoantibodies, particularly those targeting annexin.
AIMP2 antibody
AIMP2 antibody was raised in rabbit using the middle region of AIMP2 as the immunogen
Degré de pureté :Min. 95%Bin1 antibody
Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen
Degré de pureté :Min. 95%PYCR2 antibody
PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS
Chicken anti Mouse IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Degré de pureté :Min. 95%ZNF548 antibody
ZNF548 antibody was raised in rabbit using the N terminal of ZNF548 as the immunogen
Degré de pureté :Min. 95%LGI4 antibody
LGI4 antibody was raised in Rat using Mouse Lgi4 peptide coupled to carrier protein as the immunogen.SAA4 antibody
SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK
Degré de pureté :Min. 95%TCF25 antibody
TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen
Degré de pureté :Min. 95%Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the estrogen receptor alpha, a protein that plays a crucial role in various cellular processes. The antibody is derived from high-quality sources and has been extensively tested for its specificity and effectiveness.Degré de pureté :Min. 95%CGRP antibody
CGRP antibody was raised in guinea pig using calcitonin gene-related peptide conjugated to BSA as the immunogen.Degré de pureté :Min. 95%Toxoplasma gondii antibody
Toxoplasma gondii antibody was raised in mouse using 30 kDa membrane protein of purified Toxoplasma gondii as the immunogen.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
