Anticorps primaires

CAPN11 antibody was raised in Rabbit using Human CAPN11 as the immunogen

Calmodulin antibody was raised in mouse using calmodulin purified from Dictyostelium discoideum as the immunogen.

The IL10 antibody is a powerful cytotoxic agent used in Life Sciences research. It is an antibody that specifically targets and binds to interleukin-10 (IL-10), a cytokine involved in immune regulation. This antibody can be conjugated with cytotoxic agents to create a cytotoxic conjugate, which can selectively kill cells expressing IL-10 receptors.

PPP4C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

Rabbit polyclonal HTR4 antibody

TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen

Affinity purified Rabbit polyclonal ATIC antibody

Affinity purified Rabbit polyclonal Stat4 antibody

Rabbit polyclonal TERF1 antibody

The NLK antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has neutralizing properties and is able to bind to various growth factors, including fibrinogen, collagen, and fibronectin. It has been extensively tested in human serum and has shown high affinity for alpha-fetoprotein and anti-mesothelin antibodies. The NLK antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. With its exceptional binding capacity and specificity, this antibody is an invaluable resource for researchers in the field. Whether you're studying cell signaling pathways or investigating protein-protein interactions, the NLK antibody will provide reliable results and contribute to the advancement of scientific knowledge.

Affinity purified Rabbit polyclonal HRH3 antibody

GADD45GIP1 antibody was raised in Rabbit using Human GADD45GIP1 as the immunogen

Rabbit polyclonal PDIA5 antibody

Rabbit polyclonal NUB1 antibody

The SCNN1A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the enteroendocrine cells and interferon production. This antibody has been extensively studied for its glycosylation patterns and its ability to induce caspase-9 activation, leading to cell lysis. Additionally, it has shown neutralizing effects on cytotoxic growth factors and anti-DNP antibodies. The viscosity of this antibody solution is optimized for easy handling and storage. Whether you're conducting experiments or performing assays, the SCNN1A antibody is a valuable tool in your research arsenal.

Affinity purified Rabbit polyclonal Selenophosphate synthetase 1 antibody

The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.

Affinity purified Rabbit polyclonal DNAJB6 antibody

BDH1 antibody was raised in Rabbit using Human BDH1 as the immunogen

IGFBP3 antibody is a stable chemical compound that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes IGFBP3, which stands for insulin-like growth factor binding protein 3. This antibody has been extensively used in research and diagnostics to study the aberrant methylation and oxidative damage associated with IGFBP3.

PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN

FAM117B antibody was raised in Rabbit using Human FAM117B as the immunogen

Anti-Feline Leukemia Virus antibody

Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG whole molecule as the immunogen.

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

GJA9 antibody was raised using the middle region of GJA9 corresponding to a region with amino acids IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

EFNA4 antibody was raised in rabbit using the N terminal of EFNA4 as the immunogen

The BTK antibody is a powerful tool in the field of Life Sciences. It targets the Bruton's tyrosine kinase (BTK), which plays a crucial role in various cellular processes. This antibody can be used for research purposes, such as studying the effects of BTK inhibition on cell signaling pathways and protein kinase activity.

SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.

Rabbit polyclonal GPR149 antibody

Affinity purified Rabbit polyclonal IL17 Receptor D antibody

The FUS antibody is a polyclonal antibody that specifically targets the FUS protein. It recognizes the glycan structure present on the FUS protein and has neutralizing properties, making it an effective tool for studying the function of this protein. The FUS antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to have neuroprotective effects and can be used as a therapeutic agent in neurodegenerative diseases. Additionally, the FUS antibody can be used to study glycosylation processes and investigate the role of glycopeptides in cellular functions. In life sciences research, this antibody is widely used as an anti-connexin agent due to its ability to disrupt gap junctions between cells. Furthermore, it has been found to interact with collagen, suggesting potential applications in tissue engineering and regenerative medicine.

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

Affinity purified Rabbit polyclonal MAPK 8/9 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting potent bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, hindering transcription and replication processes in bacteria. Extensive research has shown its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.

Sheep anti-rabbit IgG (H+L) (HRP) was raised in sheep using rabbit IgG whole molecule as the immunogen.

Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.