Anticorps primaires

Affinity purified Rabbit polyclonal RBM15 antibody

Rabbit polyclonal OAS1 antibody

FEN1 antibody was raised in Rabbit using Human FEN1 as the immunogen

IFT20 antibody was raised in Rabbit using Human IFT20 as the immunogen

LAT antibody was raised in Rabbit using Human LAT as the immunogen

Rabbit polyclonal PRSS8 antibody

HMOX2 antibody was raised in rabbit using the N terminal of HMOX2 as the immunogen

The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.

Purified Polyclonal Beta sarcoglycan antibody

The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.

ABCE1 antibody was raised in Rabbit using Human ABCE1 as the immunogen

Rabbit polyclonal COPS5 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.

The Giardia lamblia antibody is a highly specialized product used in Life Sciences research. This antibody specifically targets the circumsporozoite protein found in Giardia lamblia, an intestinal parasite that causes giardiasis. The antibody is designed to bind to this protein and neutralize its activity.

Rabbit polyclonal GABRA1 antibody

Rabbit polyclonal RASSF7 antibody

EME1 antibody was raised in Rabbit using Human EME1 as the immunogen

CD26 antibody (biotin) was raised in mouse using human T cell clone as the immunogen.

VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.

Rabbit polyclonal SDP3 antibody (HRP)

Salmonella antibody was raised in mouse using LPS of Salmonella typhimurium as the immunogen.

The HSA antibody is a monoclonal antibody that is commonly used in steroid assays and other diagnostic tests involving human serum. It has been shown to have an inhibitory effect on the activity of certain antibodies, making it a valuable tool in research and medical settings. This specific monoclonal antibody has also been found to have anti-mesothelin properties, which makes it useful in the study and treatment of mesothelioma, a type of cancer. Additionally, the HSA antibody has demonstrated antioxidant activity and the ability to inhibit the growth factor in certain cell lines. Its versatility and wide range of applications make it an essential tool in the field of life sciences.

The FAN antibody is a highly versatile and effective tool used in various assays and hybridization techniques. It is an isothiocyanate-conjugated monoclonal antibody that specifically targets alpha-fetoprotein (AFP). This antibody has been widely used in research and diagnostic applications for the detection and quantification of AFP in biological samples.

Affinity purified Rabbit polyclonal CHEK2 antibody

The Angiotensin II antibody is a powerful tool in the field of immunology. It is an antibody specifically designed to target and bind to angiotensin II, a hormone involved in regulating blood pressure and fluid balance in the body. This antibody can be used for various applications, including research studies, diagnostic tests, and therapeutic interventions.

HIF1A antibody was raised in Rabbit using Human HIF1A as the immunogen

Affinity purified Rabbit polyclonal CKAP1 antibody

The CLDN4 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of CLDN4, a protein that is activated in certain diseases. This antibody has shown promising results in inhibiting the growth of tumors expressing high levels of alpha-fetoprotein, a known marker for liver cancer. Additionally, the CLDN4 antibody has been found to block the chemokine signaling pathway, which plays a crucial role in cell migration and inflammation. It also acts as a serine protease inhibitor, preventing the activation of enzymes involved in tumor progression. With its high specificity and efficacy, this antibody holds great potential for therapeutic applications in the field of Life Sciences.

GNAI2 antibody was raised in Rabbit using Human GNAI2 as the immunogen

LAMC2 antibody was raised in Rabbit using Human LAMC2 as the immunogen

Rabbit polyclonal GRIA1 antibody (Ser831)

Affinity purified Rabbit polyclonal Importin 7 antibody

The Carbonic Anhydrase I antibody is a growth factor that belongs to the Life Sciences category. It acts as a steroid inhibitor and is commonly used in research and laboratory settings. This antibody specifically targets carbonic anhydrase I, an enzyme involved in the regulation of pH balance in the body. The Carbonic Anhydrase I antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs. It has been extensively studied for its inhibitory effects on hepatocyte growth factor and leukemia inhibitory factor, making it a valuable tool in understanding these pathways. Additionally, this antibody has been used in studies involving annexin and c-myc proteins, further expanding its potential applications. Researchers can rely on the high quality and specificity of this antibody to enhance their experiments and gain valuable insights into cellular processes.

Rabbit polyclonal Collagen XXV antibody

TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Rabbit polyclonal SH3PXD2A antibody

Rabbit polyclonal PKC alpha beta 2 antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.