Anticorps primaires

Purified Polyclonal NAA15 antibody

The Adenosine Deaminase antibody is a highly specialized biomolecule used in Life Sciences research. It is available as both a monoclonal and polyclonal antibody, making it versatile for various applications. This antibody specifically targets and binds to adenosine deaminase, an enzyme involved in the breakdown of adenosine.

Goat anti-human IgG (Rhodamine) was raised in goat using human IgG heavy chain as the immunogen.

Rabbit polyclonal RBMS2 antibody

Affinity purified Rabbit polyclonal NDUFS8 antibody

Goat anti-rat IgM (Alk Phos) was raised in goat using rat IgM mu chain as the immunogen.

Purified Polyclonal NPY2R antibody

Purified Polyclonal PPP4R1L antibody

The GPR4 antibody is a retinoid and HDAC inhibitor that belongs to the class of monoclonal antibodies. It is used in vaccine strains and has been shown to target β-catenin, collagen, and methyl transferase. This antibody is widely used in the field of life sciences and medicine for its nuclear properties. The GPR4 antibody specifically binds to Gynura procumbens and can be used as a tool for studying various cellular processes. With its high specificity and affinity, this antibody is a valuable tool for researchers in the field of antibodies.

Rabbit polyclonal RIOK3 antibody

The CSE1L antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor (EGF) receptor. It is widely used in life sciences research to study the role of EGF and its signaling pathways. This antibody specifically binds to the activated form of the EGF receptor, inhibiting its function and preventing downstream signaling events. The CSE1L antibody has been shown to be effective in blocking the growth and proliferation of cancer cells that overexpress the EGF receptor, making it a promising therapeutic candidate for cancer treatment. Additionally, this antibody can be used as a tool in various experimental techniques, such as immunohistochemistry and Western blotting, to detect and quantify EGF receptor expression levels in different cell types and tissues. With its high specificity and sensitivity, the CSE1L antibody is an invaluable resource for researchers studying EGF-related signaling pathways and their implications in various biological processes.

Affinity purified Rabbit polyclonal ALPL antibody

The alpha CGRP antibody is a highly effective monoclonal antibody that targets beta-calcitonin gene-related peptide (CGRP). It has been extensively studied for its efficacy and safety in toxicity studies. This antibody specifically binds to CGRP, preventing its interaction with receptors and inhibiting its biological activity. In addition to its therapeutic potential, the alpha CGRP antibody has shown promising results in the treatment of mucopolysaccharidosis type I. It has been demonstrated to enhance the clearance of accumulated glycosaminoglycans, leading to improved clinical outcomes in preclinical models. Moreover, this monoclonal antibody exhibits excellent stability and minimal immunogenicity when tested in human serum and recombinant virus systems. Its high affinity for CGRP allows for efficient receptor binding and endocytic uptake into target cells. Furthermore, the alpha CGRP antibody has been engineered with a low-molecular-weight chelator deferoxamine, which enhances its stability and prolongs its half-life.

The RAE1 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to the racemase enzyme, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in immobilizing the racemase enzyme, thereby inhibiting its activity.

CD34 Monoclonal Antibody (RPE)

The EFNA4 antibody is a monoclonal antibody that targets autoantibodies against the EFNA4 protein. This protein is involved in various biological processes, including cell adhesion and migration. The EFNA4 antibody can be used in research and diagnostic applications to detect the presence of autoantibodies in human serum.

Affinity purified Mouse polyclonal IKK alpha antibody

The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.

ZNF565 antibody was raised in rabbit using the middle region of ZNF565 as the immunogen

C1R antibody is a polyclonal antibody that targets the C1R protein complex. It has neutralizing properties and can be used in various life science applications. This antibody has been shown to inhibit the activity of interferon, TNF-α, and interleukin-6. It can be used in research studies to investigate the role of C1R in different biological processes. The C1R antibody is highly specific and reliable, making it an essential tool for researchers working with biomolecules. Whether you are studying dopamine signaling or exploring the effects of haloperidol and droperidol, this antibody will provide accurate and reproducible results.

HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.

Rabbit polyclonal VEGFC antibody (HRP)

alpha 1 Antiplasmin antibody was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.

The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.

Rabbit polyclonal HMGB1 antibody (FITC)

ICAM1 antibody was raised in rabbit using highly pure recombinant human ICAM-1 as the immunogen.

The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.

Rabbit polyclonal CIB3 antibody

EIF4E2 antibody was raised in rabbit using the N terminal of EIF4E2 as the immunogen

FN3KRP antibody was raised using the N terminal of FN3KRP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA

Rabbit polyclonal URB1 antibody

Rabbit polyclonal SYN1 antibody (Ser549)

COTL1 antibody was raised in Rabbit using Human COTL1 as the immunogen

The eNOS antibody is a powerful tool used in the field of Life Sciences. It is designed to target and detect endothelial nitric oxide synthase (eNOS), an enzyme involved in the production of nitric oxide. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.

PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen

Mouse anti Human IgM is a monoclonal antibody that specifically targets human IgM antibodies. It is widely used in the field of life sciences for various applications, including immunohistochemistry, flow cytometry, and ELISA assays. This antibody has high affinity and specificity towards human IgM, making it an essential tool for researchers studying immune responses and antibody-mediated diseases.

GFP antibody (HRP) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.

Affinity purified Rabbit polyclonal SPR antibody

WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

Affinity purified Rabbit polyclonal CRLF1 antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.