Anticorps primaires

The KLF4 antibody is a powerful tool used in Life Sciences for ultrasensitive detection and analysis. It is designed to specifically target and bind to the KLF4 protein, which plays a crucial role in cell growth and development. This monoclonal antibody can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.

RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

The GPR132 antibody is a specific antibody used in Life Sciences research. It is commonly used for the detection and analysis of GPR132 protein expression. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and flow cytometry. GPR132 is involved in several biological processes including the regulation of TGF-beta signaling, interferon production, and alpha-fetoprotein expression. The GPR132 antibody has also been used in studies investigating the therapeutic effects of antibodies such as adalimumab and growth factor inhibitors. Additionally, it has been employed to detect autoantibodies and evaluate their role in diseases associated with TNF-alpha and erythropoietin signaling pathways. With its high specificity and reliability, the GPR132 antibody is an essential tool for researchers exploring various aspects of cellular function and disease mechanisms.

The MKK6 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It specifically targets the activated form of MKK6, a key enzyme involved in the natriuretic signaling pathway. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting MKK6 activation in various experimental settings.

The MBP antibody is a highly specialized antibody that targets and neutralizes myelin basic protein (MBP). MBP is a key component of the myelin sheath, which surrounds and protects nerve fibers in the central nervous system. By targeting MBP, this antibody can disrupt the normal functioning of myelin and has potential applications in autoimmune disorders such as multiple sclerosis.

The WTAP antibody is a powerful tool in life sciences research. It is an antibody that specifically targets the WTAP protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity.

Rabbit polyclonal TRPC4AP antibody

Rabbit polyclonal CD19 antibody (Tyr531)

The BHMT antibody is a monoclonal antibody that specifically targets CD33, a receptor protein expressed on the surface of certain cells. This antibody is widely used in Life Sciences research and immunoassays to detect and study CD33-related processes. The BHMT antibody has a high affinity for CD33 due to its unique binding site, which allows for accurate and reliable detection. It can be used in various applications such as flow cytometry, immunohistochemistry, and Western blotting. Additionally, this antibody has been utilized in studies investigating collagen synthesis, disulfide bond formation, glucagon signaling, TNF-α inhibition, and the presence of autoantibodies. With its exceptional specificity and sensitivity, the BHMT antibody is an invaluable tool for researchers studying CD33-related pathways and diseases.

The SH2 antibody is a monoclonal antibody that specifically targets and neutralizes the activity of growth factors in the body. It is designed to bind to specific acid residues on these growth factors, preventing them from interacting with their receptors and initiating cellular responses. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of various growth factors, including TGF-beta, epidermal growth factor (EGF), and transferrin.

The CYP1A2 antibody is a growth factor that plays a crucial role in various biological processes. It acts as an electrode, facilitating the transfer of electrons to proteins and fatty acids. This activated molecule drug also exhibits anticoagulant properties and has been shown to possess anti-VEGF (vascular endothelial growth factor) activity. Additionally, it interacts with insulin, albumin, and fibrinogen, making it a versatile therapeutic agent. The CYP1A2 antibody is a monoclonal antibody that targets endogenous hematopoietic cells and is commonly used in research and clinical settings. Its efficacy has been demonstrated in human serum, highlighting its potential for diagnostic applications.

Affinity purified Rabbit polyclonal APBB3 antibody

CD8a antibody (CY5) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.

The CBG antibody is a highly specialized antibody-drug that belongs to the class of polyclonal antibodies. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets insulin-like growth factor and thrombocytopenia, making it a valuable tool for researchers studying these areas.

CHRNE antibody was raised in rabbit using the N terminal of CHRNE as the immunogen

Rabbit polyclonal WBP11 antibody

The BPGM antibody is a powerful tool used in chemotherapy and various Life Sciences research applications. It belongs to the class of antibodies that specifically target BPGM (bisphosphoglycerate mutase), an enzyme involved in the metabolism of glucose. This antibody has high affinity for BPGM and can be used in various assays to detect its presence or measure its activity.

EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT

MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

NBN antibody was raised in Rabbit using Human NBN as the immunogen

Synaptopodin antibody was raised in mouse using rat kidney glomeruli as the immunogen.

The PIAS4 antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein known as PIAS4, which stands for Protein Inhibitor of Activated STAT 4. PIAS4 is involved in various cellular processes, including epidermal growth factor signaling and interferon response.

C20ORF144 antibody was raised using the middle region of C20Orf144 corresponding to a region with amino acids EARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEEQPRKRCRCPRPQ

CDC6 antibody was raised in Rabbit using Human CDC6 as the immunogen

PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen

The POSTN antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize the activity of periostin (POSTN), a growth factor protein involved in various cellular processes. This antibody has been extensively tested and proven to effectively bind to POSTN, inhibiting its function.

MTIF3 antibody was raised in Rabbit using Human MTIF3 as the immunogen

DUSP5 antibody was raised in rabbit using the middle region of DUSP5 as the immunogen

Rabbit polyclonal HTR7 antibody

HTR3A antibody was raised in rabbit using the N terminal of HTR3A as the immunogen

The NANP antibody is a monoclonal antibody that specifically targets the circumsporozoite protein (CSP) found on the surface of Plasmodium falciparum, the parasite responsible for malaria. This antibody has been shown to inhibit the invasion of red blood cells by the parasite and disrupt its life cycle. It binds to CSP and prevents it from interacting with host cell receptors, thereby preventing infection. The NANP antibody also has potential therapeutic applications in the treatment of other diseases, as it has been found to bind to other proteins such as collagen and tyrosine kinase-like growth factor-2. Its unique properties make it a valuable tool in life sciences research and drug development.

Rabbit polyclonal ARF5 antibody

Rabbit polyclonal UCHL5 antibody

WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

RAB2B antibody was raised in rabbit using the C terminal of RAB2B as the immunogen

CUL2 antibody was raised in rabbit using the middle region of CUL2 as the immunogen

Rabbit polyclonal OR13C8 antibody

The Syntaxin 4 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain oncogenic kinases. This antibody targets the binding proteins involved in the activation of these kinases, effectively blocking their activity and preventing the growth and proliferation of cancer cells.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.