Anticorps primaires

This antibody reacts with heavy chains on human IgG (gamma chain).

The PSA antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and is specifically designed for ultrasensitive detection. This Monoclonal Antibody has undergone surface modification to ensure high specificity and sensitivity in detecting the target protein. It can be used in various applications such as flow immunoassay and electrochemical impedance spectroscopy.

FOXL2 antibody was raised in mouse using recombinant Human Forkhead Box L2

Rabbit polyclonal MKNK1 antibody

EEF1A2 antibody was raised using the middle region of EEF1A2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

CD23 antibody was raised in mouse using human peripheral myeloma cells as the immunogen.

BNIPL antibody was raised in Rabbit using Human BNIPL as the immunogen

FOXO1 antibody was raised in Rabbit using Human FOXO1 as the immunogen

PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA

Rabbit polyclonal Lyl1 antibody

Rabbit polyclonal MADD antibody

Purified Rabbit polyclonal OR5AS1 antibody

Mouse monoclonal 41BB antibody (FITC)

ELMOD1 antibody was raised in Rabbit using Human ELMOD1 as the immunogen

The MST4 antibody is a chimeric protein that falls under the category of Life Sciences. It is a monoclonal antibody that specifically targets MST4, a protein involved in various cellular processes. This antibody has been extensively studied and characterized for its high specificity and affinity towards MST4.

Affinity purified Rabbit polyclonal DRD1 antibody

Keratin K16 antibody was raised in Guinea Pig using synthetic peptide of human keratin K16 coupled to KLH as the immunogen.

The MtSSB antibody is a diagnostic biomarker that plays a crucial role in various biological processes. It is a proline-rich protein that has been extensively studied for its potential applications in medicine. The emission of caveolin-1 and palmitate have been shown to be influenced by the presence of MtSSB antibodies. These antibodies have the ability to inhibit interferon signaling, making them valuable tools for research and diagnostics in the field of Life Sciences. As polyclonal antibodies, they can serve as a reliable detection reagent for identifying and quantifying MtSSB in samples. Additionally, their inhibitory properties make them an attractive target for developing therapeutic strategies against diseases involving reductase activity.

The PHEX antibody is a highly specialized polyclonal antibody that targets the hormone peptide interleukin-6 (IL-6). It is produced using a hybridoma cell line, which ensures high specificity and potency. This antibody acts as an inhibitory factor, neutralizing the effects of IL-6 and preventing its interaction with receptors.

Rabbit polyclonal BIK antibody (Thr33)

Rabbit polyclonal ERP29 antibody

CTTN antibody was raised in Rabbit using Human CTTN as the immunogen

Rat monoclonal CD24 antibody (FITC)

The CCL2 antibody is a monoclonal antibody that targets the chemokine CCL2, also known as monocyte chemoattractant protein-1 (MCP-1). It is used in Life Sciences research to study the role of CCL2 in various physiological and pathological processes. This antibody specifically binds to CCL2 and can be used for applications such as immunohistochemistry, flow cytometry, and ELISA. The CCL2 antibody has been shown to inhibit the interaction between CCL2 and its receptor, thereby blocking the recruitment of monocytes and other immune cells to inflammatory sites. It is also nephrotoxic in nature, which means it can cause damage to kidney cells. Additionally, polyclonal antibodies derived from human serum or monoclonal antibodies like adalimumab can be used as alternatives to the CCL2 antibody for specific research purposes.

The ALPPL2 antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets ALPPL2, which is an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting ALPPL2 expression in different tissues and cell types.

The Glyoxalase I antibody is a neuroprotective glycosylation inhibitor that targets glycopeptides such as transferrin, insulin, and fibronectin. It is widely used in Life Sciences research to study the role of glycosylation in various biological processes. This polyclonal antibody specifically binds to acidic collagens and has been shown to be effective in detecting antiphospholipid antibodies and autoantibodies. Additionally, it can be used as an insulin antibody for studying insulin signaling pathways. The Glyoxalase I antibody is a valuable tool for researchers investigating glycosylation-related mechanisms and can serve as an anticoagulant in certain applications. With its high specificity and sensitivity, this antibody is an essential component of any laboratory working with Polyclonal Antibodies.

C1orf50 antibody was raised in Rabbit using Human C1orf50 as the immunogen

Mouse monoclonal PTPRE antibody

The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.

Factor XIIIa antibody is a powerful tool used in Life Sciences research for its ability to target and detect Factor XIIIa, an enzyme involved in blood clot formation. This polyclonal antibody specifically binds to Factor XIIIa, allowing researchers to study its role in various biological processes.

SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA

HMG20A antibody was raised in Rabbit using Human HMG20A as the immunogen

Affinity purified Rabbit polyclonal TCP1 epsilon antibody

ENTPD8 antibody was raised in Rabbit using Human ENTPD8 as the immunogen

Rabbit polyclonal CKMM antibody (biotin)

COMMD1 antibody was raised in Rabbit using Human COMMD1 as the immunogen

SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Affinity purified Rabbit polyclonal RASA3 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.