Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.790 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(736 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
Affichez 1 plus de sous-catégories
75326 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
GPR87 antibody
<p>GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL</p>RAN antibody
<p>The RAN antibody is a powerful tool used in Life Sciences research. It is an alpha-fetoprotein antibody that specifically targets and binds to the RAN protein. This monoclonal antibody can be conjugated with various compounds, such as tyrosine or cytotoxic agents, to enhance its therapeutic potential. The RAN antibody has been extensively studied for its role in cell signaling pathways, particularly in collagen metabolism and matrix metalloproteinase regulation. Additionally, it has shown promising results in inhibiting tumor growth and metastasis. This highly specific antibody can also be used in diagnostic applications, such as detecting the presence of RAN protein in patient samples. Researchers and scientists rely on the RAN antibody to gain insights into cellular processes and develop novel therapies for various diseases.</p>Abscisic acid antibody
<p>The Abscisic acid antibody is a highly specialized monoclonal antibody that has been developed for specific applications in the field of biomedical research. This antibody is activated and conjugated with streptavidin, allowing for easy detection and analysis of Abscisic acid in various biological samples.</p>Goat anti Mouse IgG (H + L) (Alk Phos)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Degré de pureté :Min. 95%Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>AKT1 antibody
<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>Degré de pureté :Min. 95%CD56 antibody
<p>CD56 antibody is a monoclonal antibody that specifically targets CD56, a cell surface protein found on various immune cells. This antibody can be used in immunohistochemistry and flow cytometry to detect and quantify CD56 expression. It is commonly used in research and diagnostic applications related to the study of immune cell function and diseases such as cancer. CD56 antibody works by binding to the CD56 protein, allowing for visualization and analysis of CD56-positive cells. It is highly specific and sensitive, making it a valuable tool in life sciences research.</p>Degré de pureté :Min. 95%Chicken Serum Albumin antibody (biotin)
<p>Rabbit polyclonal Chicken Serum Albumin antibody (biotin)</p>GATA1 antibody
<p>The GATA1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is designed to target specific virus surface antigens. This antibody has been extensively tested and proven to effectively inhibit the growth and replication of viruses in human serum.</p>MTHFD1 antibody
<p>MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD</p>Testosterone 3 antibody
<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>CD298 antibody
<p>The CD298 antibody is a highly specific monoclonal antibody that targets DNA-binding proteins. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody binds specifically to the surface glycoprotein CD298, forming a specific complex that can be detected using techniques such as electrochemical impedance spectroscopy. The CD298 antibody has been shown to have high affinity and specificity for its target, making it a valuable tool for studying the function and localization of DNA-binding proteins in various biological systems. Additionally, this antibody has been used in studies investigating the role of CD298 in processes such as glutamate signaling and proteolytic activity. With its versatility and reliability, the CD298 antibody is an essential tool for researchers working in the field of DNA-binding proteins.</p>Degré de pureté :Min. 95%Synaptophysin antibody
<p>The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.</p>LARGE antibody
<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>Degré de pureté :Min. 95%HUS1B antibody
<p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>Akt antibody (Thr450)
<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase crucial for regulating key cellular functions, including growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt/mTOR pathway, which integrates external signals to maintain cellular function and adaptation. Humans express three Akt isoforms—Akt1, Akt2, and Akt3—each encoded by a distinct gene. The activation of Akt generally starts when external signals like growth factors or insulin bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane, which attracts Akt to the membrane, where it undergoes phosphorylation at two specific sites, Thr308 and Ser473, to become fully active. Once activated, Akt moves through the cell to phosphorylate target proteins involved in various cellular pathways.The primary functions of Akt include promoting cell survival by inhibiting apoptosis through the inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also supports cell growth and proliferation by activating mTOR, a central regulator of protein synthesis, while suppressing growth-arrest pathways. Akt plays a key role in metabolic regulation by increasing glucose uptake and glycolysis, largely through GLUT4 translocation and hexokinase activation, which is particularly important in muscle and fat tissues. It contributes to angiogenesis by upregulating VEGF expression, aiding tissue growth and repair, and it promotes cell migration, facilitating wound healing as well as the spread of cancer cells in malignancy. Due to its broad role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor growth, which makes the PI3K/Akt/mTOR pathway a target for many cancer therapies. Additionally, Akt's role in glucose metabolism links it to insulin signaling, where defects can impair glucose uptake, leading to insulin resistance and type 2 diabetes.</p>RB1 antibody
<p>The RB1 antibody is a hydrophilic polyclonal antibody that specifically targets the retinoblastoma protein (RB1). This antibody is widely used in life sciences research to study the methylation of RB1 and its role in various cellular processes. RB1 is a tumor suppressor protein that regulates cell cycle progression and inhibits cell growth. Methylation of RB1 can affect its function, leading to abnormal cell proliferation and the development of diseases such as retinoblastoma and hepatocellular carcinoma. The RB1 antibody allows researchers to detect and analyze the methylation status of RB1, providing valuable insights into its role in disease development and potential therapeutic interventions. With its high specificity and sensitivity, this antibody is an essential tool for studying methyltransferase activity and understanding the molecular mechanisms underlying various biological processes.</p>
