Anticorps primaires

<p>The ROD1 antibody is a neutralizing antibody that belongs to the category of polyclonal antibodies. It is used in life sciences research to study the role of interleukins and other growth factors. This antibody specifically targets nuclear binding proteins and can be used in various assays and experiments. Whether you need a monoclonal or polyclonal version, the ROD1 antibody is an essential tool for researchers looking to study the effects of specific proteins or develop new drug antibodies. With its high specificity and reliability, this antibody is a valuable addition to any laboratory's toolkit.</p>

<p>Rabbit polyclonal SERPINB8 antibody</p>

<p>Rabbit polyclonal PPP3CA antibody</p>

<p>KCNF1 antibody was raised in Rabbit using Human KCNF1 as the immunogen</p>

<p>Rabbit polyclonal PNCK antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>Rabbit polyclonal SRGAP3 antibody</p>

<p>Rabbit anti-rat IgG (H+L) (FITC) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS</p>

<p>Rabbit polyclonal ZNHIT1 antibody</p>

<p>Rabbit polyclonal RSU1 antibody</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>Rabbit polyclonal APBB1IP antibody</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>

<p>The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.</p>

<p>The RAN antibody is a powerful tool used in Life Sciences research. It is an alpha-fetoprotein antibody that specifically targets and binds to the RAN protein. This monoclonal antibody can be conjugated with various compounds, such as tyrosine or cytotoxic agents, to enhance its therapeutic potential. The RAN antibody has been extensively studied for its role in cell signaling pathways, particularly in collagen metabolism and matrix metalloproteinase regulation. Additionally, it has shown promising results in inhibiting tumor growth and metastasis. This highly specific antibody can also be used in diagnostic applications, such as detecting the presence of RAN protein in patient samples. Researchers and scientists rely on the RAN antibody to gain insights into cellular processes and develop novel therapies for various diseases.</p>

<p>Rabbit polyclonal CXCL10 antibody (FITC)</p>