Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.790 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(736 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
Affichez 1 plus de sous-catégories
75326 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
EPHX1 antibody
<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI</p>Degré de pureté :Min. 95%TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Degré de pureté :Min. 95%HSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>Cytomegalovirus (CMV) EIA Antigen
<p>Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%LRRC8E antibody
<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>Degré de pureté :Min. 95%SLC46A1 antibody
<p>SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR</p>Degré de pureté :Min. 95%SPINK6 antibody
<p>SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen</p>Degré de pureté :Min. 95%anti-Testosterone Monoclonal
<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>Degré de pureté :Min. 95%CEACAM6 antibody
<p>CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI</p>CCDC138 antibody
<p>CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG</p>ZNF284 antibody
<p>ZNF284 antibody was raised in rabbit using the C terminal of ZNF284 as the immunogen</p>Degré de pureté :Min. 95%Goat anti Mouse IgG (H + L) (Alk Phos)
<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>Degré de pureté :Min. 95%LARGE antibody
<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>Degré de pureté :Min. 95%Pnpla6 antibody
<p>Pnpla6 antibody was raised in rabbit using the C terminal of Pnpla6 as the immunogen</p>Degré de pureté :Min. 95%
