Anticorps primaires

The SOX2 antibody is a highly specific and reliable tool used in immunohistochemistry and other life science research applications. This monoclonal antibody binds to the SOX2 antigen, which is a nuclear DNA-binding protein involved in the regulation of embryonic development and cell differentiation. The SOX2 antibody has been extensively validated for its performance in various experimental techniques, including electrochemical impedance spectroscopy.

Purified Polyclonal RPL3 antibody

KRT17 antibody was raised in Rabbit using Human KRT17 as the immunogen

The RAB39A antibody is a highly effective tool used in various research and diagnostic applications. This antibody specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs.

Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.

NUSAP1 antibody was raised using the C terminal of NUSAP1 corresponding to a region with amino acids LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ

The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.

Morphine antibody was raised in mouse using Morphine-3-BSA as the immunogen.

NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP

Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.

Rabbit polyclonal POLM antibody

Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.

Rabbit polyclonal SPANXC antibody

Zfp472 antibody was raised in rabbit using the N terminal of Zfp472 as the immunogen

Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.

EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.

The PLXDC1 antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has been extensively studied for its role in endothelial growth and angiogenesis. This antibody specifically targets PLXDC1, a receptor that plays a crucial role in regulating the growth and development of blood vessels.

CD117 antibody (Spectral Red) was raised in rat using murine CD117/c-Kit as the immunogen.

GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Rabbit polyclonal RIC8B antibody

The Sumo1 antibody is a polyclonal antibody that is used for the immobilization of human serum on an electrode. It is commonly used in research and laboratory settings to study the binding proteins and inhibitors involved in various cellular processes. This antibody has also been shown to have neutralizing effects on interferon, making it a valuable tool in immunology research. Additionally, the Sumo1 antibody has demonstrated neuroprotective properties and has been investigated for its potential use in treating neurodegenerative disorders. However, it is important to note that this antibody may have teratogenic effects and should be handled with caution. In the field of Life Sciences, the Sumo1 antibody plays a crucial role in understanding cellular pathways and protein interactions.

SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP

Calibrator for Chicken ELISA Kit

The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.

Rabbit Polyclonal Synaptotagmin II antibody (Thr202)

CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS

Mouse monoclonal PYCRL antibody

NIP7 antibody was raised in Rabbit using Human NIP7 as the immunogen

The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.

Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.

Purified Polyclonal NDUFS1 antibody

The GPR18 antibody is a polyclonal antibody used in the field of Life Sciences. It is commonly used in various assays and experiments to study the functions and interactions of GPR18, a glycoprotein receptor. This antibody is highly specific and has been proven effective in detecting GPR18 in different biological samples.

Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen

FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.

The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.

The GPR132 antibody is a specific antibody used in Life Sciences research. It is commonly used for the detection and analysis of GPR132 protein expression. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and flow cytometry. GPR132 is involved in several biological processes including the regulation of TGF-beta signaling, interferon production, and alpha-fetoprotein expression. The GPR132 antibody has also been used in studies investigating the therapeutic effects of antibodies such as adalimumab and growth factor inhibitors. Additionally, it has been employed to detect autoantibodies and evaluate their role in diseases associated with TNF-alpha and erythropoietin signaling pathways. With its high specificity and reliability, the GPR132 antibody is an essential tool for researchers exploring various aspects of cellular function and disease mechanisms.

GSTM4 antibody was raised in Rabbit using Human GSTM4 as the immunogen

HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.

ACP6 antibody was raised in Rabbit using Human ACP6 as the immunogen

Rabbit polyclonal RUVBL2 antibody