Anticorps primaires

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>NAT8 antibody was raised in Rabbit using Human NAT8 as the immunogen</p>

<p>MRPL45 antibody was raised in rabbit using the C terminal of MRPL45 as the immunogen</p>

<p>ZNF326 antibody was raised in rabbit using the N terminal of ZNF326 as the immunogen</p>

<p>Ccdc90b antibody was raised in rabbit using the N terminal of Ccdc90b as the immunogen</p>

<p>Purified Polyclonal HP1 alpha antibody</p>

<p>The Uromodulin antibody is a highly specialized biotinylated antibody that is used in various research applications in the field of Life Sciences. This antibody specifically targets and binds to uromodulin, a protein found in high concentrations in human hepatocytes. The Uromodulin antibody has been extensively characterized and validated for its specificity and sensitivity.</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>

<p>Purified Polyclonal RPL35 antibody</p>

<p>Rabbit polyclonal NMUR1 antibody</p>

<p>Please enquire for more information about Affinity Purified anti-C-Myc Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ZNF543 antibody was raised in rabbit using the middle region of ZNF543 as the immunogen</p>

<p>Purified Polyclonal GAD1/2 antibody</p>

<p>SLC6A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF</p>

<p>The IkB alpha antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activated form of IkB alpha, a protein that plays a crucial role in cellular signaling pathways. By binding to IkB alpha, this antibody prevents its interaction with 14-3-3 isoforms, thereby inhibiting downstream signaling events.</p>

<p>ZGPAT antibody was raised using the middle region of ZGPAT corresponding to a region with amino acids LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS</p>

<p>Purified Polyclonal HKR1 antibody</p>

<p>Rabbit polyclonal TPD54 antibody</p>

<p>IFN beta antibody was raised in mouse using human interferon beta as the immunogen.</p>

<p>Rabbit polyclonal EPHB6 antibody</p>

<p>Rabbit polyclonal SCN1B antibody</p>

<p>Rabbit Polyclonal Abl1 antibody (Tyr412)</p>

<p>LZTFL1 antibody was raised in Rabbit using Human LZTFL1 as the immunogen</p>

<p>The p70S6k antibody is an acidic monoclonal antibody that specifically targets the cysteine disulfide region of the p70S6k protein. It has been widely used in Life Sciences research to study the role of p70S6k in various cellular processes. This antibody has neutralizing activity against oncostatin and natriuretic factors, making it a valuable tool for investigating their signaling pathways. Additionally, the p70S6k antibody has been used as a blood biomarker for ultrasensitive detection of leukemia inhibitory factor in human serum samples. With its high affinity and specificity, this monoclonal antibody is an essential tool for researchers studying the primary amino acid sequence and structure of p70S6k using techniques such as electrode-based assays.</p>

<p>CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS</p>

<p>SCCPDH antibody was raised in rabbit using the middle region of SCCPDH as the immunogen</p>