Anticorps primaires

<p>Rabbit polyclonal TMEM41A antibody</p>

<p>Rabbit polyclonal PIH1D1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>Adducin beta 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>NADK antibody was raised in Rabbit using Human NADK as the immunogen</p>

<p>ITPKA antibody was raised in Rabbit using Human ITPKA as the immunogen</p>

<p>The TFCP2 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the transcription factor CP2 (TFCP2) and is commonly used to study its role in various cellular processes. This antibody has been shown to effectively detect TFCP2 in different experimental settings, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>Rabbit polyclonal TFDP1 antibody</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>

<p>Rabbit polyclonal TMCO6 antibody</p>

<p>MAST1 antibody was raised in Rabbit using Human MAST1 as the immunogen</p>

<p>Rabbit polyclonal TUBA1A antibody</p>

<p>FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>Rabbit polyclonal RDH12 antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>