Anticorps primaires

Purified Goat anti-human Eotaxin polyclonal antibody

Rabbit polyclonal OR8S1 antibody

Mouse monoclonal CD144 antibody (PE)

BNIPL antibody was raised in Rabbit using Human BNIPL as the immunogen

Rabbit polyclonal GPR12 antibody

The SP1 antibody is a glycoprotein inhibitor that is pegylated and classified as a monoclonal antibody. It is commonly used in Life Sciences research and has various applications. The SP1 antibody has been found to be effective in neutralizing the activity of trastuzumab, an antibody used in the treatment of breast cancer. Additionally, it has shown potential as a therapeutic agent for targeting specific growth factors, such as glucagon and fatty acid receptors. This antibody exhibits cytotoxic properties and can inhibit the growth of cancer cells by blocking essential cellular processes. Furthermore, the SP1 antibody has been utilized in studies involving glutamate receptors and has proven to be valuable in understanding their functions. Overall, this highly specialized antibody offers great potential for researchers seeking to investigate various biological pathways and targets within the human body.

The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.

Goat anti-armenian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

The EFEMP1 antibody is a cytotoxic monoclonal antibody that has neutralizing properties. It specifically targets alpha-fetoprotein, a protein that is often overexpressed in certain types of cancer cells. This antibody binds to the alpha-fetoprotein and inhibits its function, leading to cell death. The EFEMP1 antibody has been extensively studied in the field of life sciences and has shown promising results as a potential medicament for cancer treatment. Additionally, it has been found to interfere with collagen synthesis and inhibit the activity of growth factors, further contributing to its anti-cancer effects. This highly specialized antibody holds great potential in the development of targeted therapies for various types of cancers.

CD25 antibody (PE) was raised in rat using alpha chain IL-2 receptor as the immunogen.

Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymocytes as the immunogen.

Affinity purified Rabbit polyclonal UKHC antibody

Affinity purified Rabbit polyclonal Docking protein 3 antibody

UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

Mouse monoclonal CD20 antibody (biotin)

CD122 antibody (FITC) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.

The PNMT antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of norepinephrine, a neurotransmitter involved in various physiological processes.

RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA

Affinity purified Rabbit polyclonal TCP1 epsilon antibody

The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.

Affinity purified Rabbit polyclonal BCAP31 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The metabolization of this drug involves various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.

MAP2K6 antibody was raised in Rabbit using Human MAP2K6 as the immunogen

EGFR antibody was raised in Rabbit using Human EGFR as the immunogen

SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE

CD45.2 antibody (CY5) was raised in mouse using CD45.2 as the immunogen.

HIBADH antibody was raised in Rabbit using Human HIBADH as the immunogen

Rabbit polyclonal ZNF193 antibody

GCLM antibody was raised in Rabbit using Human GCLM as the immunogen

ECD antibody was raised in Rabbit using Human ECD as the immunogen

Affinity purified Rabbit polyclonal NDUFS8 antibody

Rat monoclonal Toll-like receptor 9 antibody (PE)

Rabbit polyclonal UBE2A antibody

The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

MRPL10 antibody was raised in Rabbit using Human MRPL10 as the immunogen

FGF23 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets FGF23, a glycosylated protein involved in mineralization regulation. The FGF23 antibody has been developed to neutralize the activity of FGF23, making it an essential tool for researchers studying bone and mineral metabolism. This antibody is produced using advanced techniques, including colloidal gold labeling or microsphere conjugation, ensuring high specificity and sensitivity. Whether used in immunoassays or as a research tool, the FGF23 antibody provides valuable insights into the role of FGF23 and its signaling pathways, including protein kinase and 3-kinase activation.

IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.