Anticorps primaires

<p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>

<p>SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids  GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH</p>

<p>Rabbit Polyclonal Tsc2 antibody (Ser939)</p>

<p>Rabbit polyclonal GRK1 antibody (Ser21)</p>

<p>RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA</p>

<p>GPR88 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KCNA10 antibody was raised using the N terminal of KCNA10 corresponding to a region with amino acids DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI</p>

<p>Purified Polyclonal IKK alpha antibody</p>

<p>CYP2A7 antibody was raised using the N terminal of CYP2A7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN</p>

<p>Purified Rabbit polyclonal PUB69 antibody</p>

<p>USP2 antibody was raised in rabbit using the N terminal of USP2 as the immunogen</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>

<p>KLHDC5 antibody was raised in rabbit using the middle region of KLHDC5 as the immunogen</p>

<p>Rabbit Polyclonal CSFR antibody (Tyr809)</p>

<p>The CDK2 antibody is a highly effective tool for researchers in the field of life sciences. This monoclonal antibody specifically targets and binds to the activated form of CDK2, a crucial protein involved in cell cycle regulation. By inhibiting the activity of CDK2, this antibody can effectively block cell proliferation and growth.</p>

<p>The AXL antibody is a highly specific monoclonal antibody that targets the AXL receptor tyrosine kinase. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been validated for use in multiple species and has shown high specificity and sensitivity.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>Rabbit polyclonal PLCXD1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy through the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, this drug specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS</p>

<p>Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS</p>

<p>Rabbit polyclonal PPP3CA antibody</p>

<p>ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH</p>

<p>Rabbit polyclonal TIMP4 antibody</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>