Anticorps primaires

Rabbit polyclonal GABRB1 antibody

The Atrazine antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets atrazine, a commonly used herbicide. This antibody can be used in various research applications, particularly in studies involving mesenchymal stem cells and microvessel density.

TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen

Affinity purified Rabbit polyclonal CBFA1 antibody

The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.

Rabbit polyclonal CCL5 antibody (HRP)

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it has strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Rabbit polyclonal CKS1 antibody

Rabbit polyclonal SDP3 antibody (HRP)

Affinity purified Mouse polyclonal XRCC6 antibody

CAPN6 antibody was raised in Rabbit using Human CAPN6 as the immunogen

Purified Polyclonal Inhibin beta A antibody

Mouse monoclonal FSHB antibody

Rabbit polyclonal IKK gamma antibody

Rat monoclonal CD8 antibody (PE); IgG2b kappa

RNF2 antibody was raised in Rabbit using Human RNF2 as the immunogen

Affinity purified Rabbit polyclonal Cofilin 2 antibody

CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface protein involved in various immune responses. This antibody has been shown to neutralize the activity of CD11b and inhibit its function in immune cells. CD11b antibody has been used in research studies to investigate the role of CD11b in different biological processes, including hepcidin regulation, interleukin-6 signaling, and syncytia formation. It has also been shown to modulate intracellular signaling pathways such as the p38 MAPK pathway and protein kinases. This antibody is widely used in life sciences research for its ability to selectively bind and block CD11b activity, making it a valuable tool for studying immune responses and developing potential therapeutic interventions.

Affinity purified Rabbit polyclonal ZNF211 antibody

Monoclonal antibody against α4-integrin

KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

MAGED2 antibody was raised in Rabbit using Human MAGED2 as the immunogen

Rabbit polyclonal Ferritin heavy chain antibody (FITC)

Affinity purified Rabbit polyclonal TRAM1 antibody

Affinity purified Rabbit polyclonal BCAP31 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes.

The Fukutin antibody is a specific antibody that belongs to the group of Polyclonal Antibodies. It is an immunosuppressant and growth factor that plays a crucial role in various biological processes. This antibody can be used in research laboratories for studying protein-protein interactions, as well as in clinical settings for diagnostic purposes.

HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.

Fetuin A antibody is a highly specific monoclonal antibody that targets the protein fetuin A. This protein plays a crucial role in various biological processes, including collagen synthesis, growth factor signaling, and protein kinase activation. The antibody recognizes specific acid residues on the fetuin A protein and effectively inhibits its activity.

CD45.2 antibody (CY5) was raised in mouse using CD45.2 as the immunogen.

Rabbit polyclonal TBCB antibody

FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.

Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.

ERCC6 antibody was raised in mouse using recombinant Human Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6 (Ercc6)

CHMP1B antibody was raised in Rabbit using Human CHMP1B as the immunogen

The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.