Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.790 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(736 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
Affichez 1 plus de sous-catégories
75326 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
LARGE antibody
<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>Degré de pureté :Min. 95%ITGA6 antibody
<p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>Mapk12 antibody
<p>Mapk12 antibody was raised in rabbit using the C terminal of Mapk12 as the immunogen</p>Degré de pureté :Min. 95%Goat anti Human IgG (Texas Red)
<p>Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.</p>Degré de pureté :Min. 95%Factor IX antibody (HRP)
<p>Factor IX antibody (HRP) was raised in goat using human Factor IX purified from plasma as the immunogen.</p>STAT6 antibody
<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>AHCTF1 antibody
<p>AHCTF1 antibody was raised in mouse using recombinant Human At Hook Containing Transcription Factor 1 (Ahctf1)</p>KCNG1 antibody
<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>CALB1 antibody
<p>CALB1 antibody was raised in rabbit using the C terminal of CALB1 as the immunogen</p>Degré de pureté :Min. 95%GPR87 antibody
<p>GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL</p>FABP3 antibody
<p>FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV</p>
