Anticorps primaires

<p>MPS1 antibody was raised in Mouse using a purified recombinant fragment of MPS1 expressed in E. coli as the immunogen.</p>

<p>The CPA1 antibody is a monoclonal antibody that specifically targets the CPA1 enzyme. This antibody has been extensively studied for its protease activity and its potential applications in the field of life sciences. It has been shown to effectively inhibit the activity of CPA1, which plays a crucial role in various physiological processes.</p>

<p>Purified Polyclonal PSMC6 antibody</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>Rabbit polyclonal PNCK antibody</p>

<p>ASH1L antibody was raised in mouse using recombinant Ash1 (Absent, Small, Or Homeotic)-Like (Drosophila) (Ash1L)</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>Purified Polyclonal CD246 antibody</p>

<p>Sbk1 antibody was raised in rabbit using the C terminal of Sbk1 as the immunogen</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant rat TNF-alpha as the immunogen.</p>

<p>Purified Polyclonal Kalirin antibody</p>

<p>MAP4K4 antibody was raised using the N terminal of MAP4K4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ</p>

<p>The RRM2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets the growth hormone receptor and has been shown to inhibit lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used in various applications such as immunohistochemistry and Western blotting. It is available both as polyclonal antibodies, which offer broad specificity, and monoclonal antibodies, which provide high specificity. The RRM2 antibody has also been studied as a potential therapeutic target for inhibiting tyrosine kinase activity and blocking endothelial growth factor signaling pathways. Additionally, it has been used in combination with other inhibitors, such as trastuzumab, to enhance their efficacy. With its versatility and potential applications, the RRM2 antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>Rabbit polyclonal ELMOD2 antibody</p>

<p>Rabbit Polyclonal PPP1R2 antibody (Ser120+Ser121)</p>

<p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

<p>The CDKN1B antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers and scientists working with polymerase chain reactions (PCR) and studying various biological processes. This monoclonal antibody specifically targets CDKN1B, which is a protein involved in cell cycle regulation.</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Rabbit polyclonal RRAS antibody</p>

<p>LZTFL1 antibody was raised in Rabbit using Human LZTFL1 as the immunogen</p>

<p>ADRA1B antibody was raised in rabbit using the C terminal of ADRA1B as the immunogen</p>

<p>Mouse monoclonal PDE4B antibody</p>

<p>Purified Rabbit polyclonal p53 antibody (Ser392)</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>