Anticorps primaires

IL4 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is commonly used in life sciences research and has various applications in the field. IL4 antibody can be used as a tool to study the role of interleukin-4 (IL-4) in immune responses and inflammation. It can also be used as an inhibitor to block the activity of IL-4, which is involved in anti-angiogenesis and other processes.

CD70 antibody was raised in rabbit using the N terminal of CD70 as the immunogen

AFP antibody was raised in Rabbit using Human AFP as the immunogen

Affinity purified Rabbit polyclonal Apoptosis enhancing nuclease antibody

Mouse monoclonal Allophycocyanin antibody (biotin)

Mouse monoclonal CD34 antibody (PE)

The CD27 antibody is a neutralizing monoclonal antibody that targets the CD27 protein. CD27 is a cell surface receptor that plays a crucial role in immune responses and lymphocyte activation. This antibody binds to CD27, preventing its interaction with other molecules and inhibiting downstream signaling pathways. It has been shown to inhibit the activity of glutamate phosphatase and block the production of autoantibodies. The CD27 antibody can be used in various research applications in the field of life sciences, including immunology and cell biology. It is commonly used in experiments involving activated lymphocytes, as well as in studies investigating cytotoxicity and growth factors. This high-quality monoclonal antibody is produced using advanced techniques and has been extensively tested for specificity and functionality. Its purity and reliability make it an excellent choice for researchers seeking accurate and reproducible results.

Rat monoclonal CD150 antibody (biotin)

Affinity purified Rabbit polyclonal Proteasome 20S alpha 2 antibody

Haptoglobin antibody is a monoclonal antibody that specifically targets haptoglobin, a human protein found in plasma. It is widely used in Life Sciences research to study the role of haptoglobin in various biological processes. Haptoglobin antibody has been shown to bind to haptoglobin expressed in human hepatocytes and inhibit its function. This antibody can also be used for immunohistochemistry and Western blotting to detect haptoglobin levels in human serum samples. Additionally, haptoglobin antibody has been used in studies investigating the interaction between haptoglobin and other molecules such as fatty acids, lectins, and transport proteins. Its specificity and high affinity make it a valuable tool for researchers studying the functions of haptoglobin and its polymorphic variants.

The FPR1 antibody is a highly specialized medicament used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to e-cadherin, a glycoprotein involved in cell adhesion. This colloidal antibody has been extensively studied for its inhibitory effects on e-cadherin expression and its potential as a therapeutic agent in various diseases.

DOK1 antibody was raised in rabbit using the C terminal of DOK1 as the immunogen

INTS8 antibody was raised in Rabbit using Human INTS8 as the immunogen

ERC2 antibody was raised in Rabbit using Human ERC2 as the immunogen

CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.

Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.

Affinity purified Rabbit polyclonal Nucleoporin p62 antibody

Rabbit polyclonal ELF1 antibody

Rabbit polyclonal RRH antibody

Rabbit polyclonal SURF1 antibody

The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.

FBP1 antibody was raised in Rabbit using Human FBP1 as the immunogen

Affinity purified Rabbit polyclonal CaMKII delta antibody

Donkey anti Goat IgG (H + L) secondary antibody

FAF1 antibody was raised in Rabbit using Human FAF1 as the immunogen

LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ

H2AFX antibody was raised in Rabbit using Human H2AFX as the immunogen

PDE1B antibody was raised in rabbit using the middle region of PDE1B as the immunogen

Rabbit polyclonal TGF beta Receptor 2 antibody

Mouse monoclonal FCGR2A antibody

Goat anti-cat IgG (H+L) was raised in goat using feline IgG whole molecule as the immunogen.

The DDT antibody is a monoclonal antibody that belongs to the globulin class of antibodies. It is specifically designed for use in Life Sciences research and has neutralizing properties against the DDT antigen. This antibody can effectively bind to and inhibit the activity of DDT, a toxic chemical compound widely used as an insecticide.

Rabbit polyclonal AKAP2 antibody

The CD40L antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and neutralize the CD40 ligand, which is involved in various autoimmune and inflammatory diseases. This antibody has been extensively studied for its ability to inhibit the production of autoantibodies, such as antiphospholipid antibodies, and regulate the immune response.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.