Anticorps primaires

Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.

Affinity purified Rabbit polyclonal RASAL1 antibody

Rabbit polyclonal GPR126 antibody

GHITM antibody was raised in Rabbit using Human GHITM as the immunogen

Mouse monoclonal CD10 antibody (FITC)

The V5 Tag antibody is a monoclonal antibody used in Life Sciences research. It specifically binds to the V5 epitope, a small peptide sequence that is commonly fused to target proteins for detection and purification purposes. This antibody is widely used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

IRF3 antibody was raised in Rabbit using Human IRF3 as the immunogen

RAB5a antibody was raised in mouse using recombinant human Rab5a (1-215aa) purified from E. coli as the immunogen.

The Syntaxin 4 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain oncogenic kinases. This antibody targets the binding proteins involved in the activation of these kinases, effectively blocking their activity and preventing the growth and proliferation of cancer cells.

C5AR1 antibody was raised in Rabbit using Human C5AR1 as the immunogen

The FABP3 antibody is a highly specialized protein used in the field of Life Sciences. It belongs to the group of Polyclonal Antibodies and monoclonal antibodies that are widely used in research and diagnostic applications. This antibody specifically targets FABP3, which stands for fatty acid-binding protein 3.

Rabbit polyclonal ES8L3 antibody

Rabbit polyclonal MAP4K6 antibody

The CRYAB antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the CRYAB protein, also known as alpha-crystallin B chain. This protein plays a crucial role in various cellular processes, including cytoprotection, chaperone activity, and regulation of apoptosis.

ALDH1B1 antibody was raised using the middle region of ALDH1B1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Rabbit polyclonal RDH13 antibody

TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.

The MCM2 antibody is a highly specialized growth factor that targets adipose tissue. It specifically binds to the adiponectin receptor, promoting the activation of epidermal growth factors and chemokines. This antibody has been shown to enhance the production of adiponectin, interferon, and dopamine in adipose cells.

Goat anti-mouse IgG/IgM (H+L) was raised in goat using murine IgG and IgM whole molecules as the immunogen.

The CSA antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the circumsporozoite protein (CSP), which is found on the surface of the malaria parasite. This antibody can be used to detect the presence of CSP in samples, making it a valuable tool for studying the biology and transmission of malaria.

TCP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH

The Tau antibody is a highly specialized monoclonal antibody that targets the insulin protein. It has been extensively studied in the field of Life Sciences and has shown remarkable potential for neutralizing insulin activity. This antibody specifically binds to insulin, inhibiting its function and preventing it from interacting with its receptors.

The PPP1R9B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein PPP1R9B, also known as neurabin-2 or spinophilin. This antibody is commonly used in various applications, including immunohistochemistry, western blotting, and ELISA assays.

The JNK antibody is a highly specialized monoclonal antibody that targets the protein kinase known as JNK (c-Jun N-terminal kinase). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various assays. It has been found to inhibit the activation of JNK, which plays a crucial role in cellular processes such as apoptosis, inflammation, and glucose metabolism. Additionally, this antibody has shown potential in targeting other proteins like prorenin and sclerostin. With its high specificity and efficacy, the JNK antibody is a valuable tool for researchers in their quest to understand and manipulate cellular signaling pathways.

Rabbit polyclonal RPAP2 antibody

Affinity purified Rabbit polyclonal MAF1 antibody

Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen

DDX21 antibody was raised in Rabbit using Human DDX21 as the immunogen

The NOSIP antibody is a highly specialized antibody that targets endothelial growth factors. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the Life Sciences field. This antibody has been extensively tested and validated for its specificity and sensitivity.

Phospho MBP antibody was raised in mouse using a sythetic peptide corresponding to the human myelin basic protein sequence phosphorylated at Thr98 and coupled to tuberculin as the immunogen.

Rabbit polyclonal Clavesin antibody

The Methcathinone Antibody is a highly specialized antibody that exhibits insulin-like properties and interferes with the function of specific antigens. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to effectively bind to recombinant proteins, growth factors, interleukins, and IFN-gamma, inhibiting their activity and preventing their interaction with target receptors. Additionally, this antibody has been immobilized on activated fatty acids, allowing for easy purification and isolation of target molecules. With its unique tyrosine-based structure, the Methcathinone Antibody offers a valuable tool for researchers in need of a reliable and efficient method for studying sumoylation processes and investigating the role of specific antigens in cellular functions.

Rat Calnuc antibody was raised using the C terminal Of Rat Calnuc/Rgd:620030 corresponding to a region with amino acids EQPPVLPQLDSQHL

MED1 antibody is a protein that belongs to the category of polyclonal antibodies. It is commonly used in the field of life sciences for various applications. MED1 antibody specifically targets erythropoietin, adalimumab, and other autoantibodies. It can also be used to detect and measure levels of androgen, TGF-beta, alpha-fetoprotein, interferon, and other growth factors. This specific antibody provides researchers with a valuable tool for studying the role of these proteins in various biological processes and diseases. With its high specificity and sensitivity, MED1 antibody ensures accurate and reliable results in experiments and diagnostic assays.

Rabbit polyclonal Tyrosine Hydroxylase antibody (Ser40)

ATP5D antibody was raised in Rabbit using Human ATP5D as the immunogen

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.