Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
p73 antibody
The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.
MTCH2 antibody
MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
NAB1 antibody
NAB1 antibody was raised in mouse using recombinant Human Ngfi-A Binding Protein 1 (Egr1 Binding Protein 1)
ADAM19 antibody
ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET
Degré de pureté :Min. 95%MARVELD2 antibody
MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
Degré de pureté :Min. 95%Cytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
LOC344065 antibody
LOC344065 antibody was raised in rabbit using the middle region of LOC344065 as the immunogen
Degré de pureté :Min. 95%Fos antibody
The Fos antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear protein Fos, which plays a crucial role in cellular processes such as glucose transporter regulation and growth factor signaling. This antibody is commonly used to study thrombotic microangiopathy, a condition characterized by abnormal clot formation in small blood vessels. By binding to Fos, the antibody allows researchers to visualize and analyze the activation of this important protein. In addition to its use in research, there are also polyclonal antibodies available for detecting other components of the actin filaments, such as phalloidin or actin itself. These antibodies are valuable tools for studying atypical hemolytic disorders and other conditions involving actin dynamics. With their high specificity and sensitivity, these antibodies provide researchers with reliable results for their experiments.
SERPINF2 antibody
The SERPINF2 antibody is a highly effective neutralizing agent that has been extensively studied in various scientific fields, including Life Sciences. It is a monoclonal antibody that has shown promising results in inhibiting the activity of SERPINF2, a protein involved in adipose tissue regulation. Through electrochemical impedance spectroscopy, it has been demonstrated that this antibody effectively binds to SERPINF2 and prevents its interaction with other molecules in the reaction solution.
CKMM antibody
CKMM antibody was raised in mouse using CKMM purified from human smooth muscle as the immunogen.IL4 antibody
The IL4 antibody is a pegylated monoclonal antibody that is used in the field of Life Sciences as a medicament. It has been extensively studied for its glycation properties, particularly in human serum. The IL4 antibody can be immobilized onto a carbon electrode and used in electrochemical detection methods. It has also been used in conjunction with adeno-associated viruses to deliver therapeutic antibodies directly to specific cells or tissues. Additionally, the IL4 antibody has been shown to bind to actin filaments and can be labeled with phalloidin for visualization purposes. With its wide range of applications and specificity, the IL4 antibody is a valuable tool in various research fields.
SATB1 antibody
The SATB1 antibody is a highly specialized growth factor that belongs to the class of antibodies. It is a monoclonal antibody that has cytotoxic and antiangiogenic properties, making it an effective proliferation inhibitor. In the field of Life Sciences, this antibody is widely used for its ability to neutralize various growth factors, including epidermal growth factor (EGF), transforming growth factor-beta (TGF-beta), and chemokines. The SATB1 antibody specifically targets low-molecular-weight endothelial growth factors, inhibiting their activity and preventing angiogenesis. This monoclonal antibody is a valuable tool in research and clinical applications related to cancer, inflammation, and other diseases involving abnormal cell growth.
TALDO1 antibody
The TALDO1 antibody is a highly specialized protein that belongs to the group of polyclonal antibodies. It is used in life sciences research to detect and study transaldolase, an important enzyme involved in nucleic acid metabolism. This antibody specifically binds to TALDO1, making it a valuable tool for identifying and quantifying this biomarker in various biological samples. By targeting specific polypeptides, the TALDO1 antibody enables researchers to gain insights into the role of transaldolase in cellular processes and disease development. Its high specificity and sensitivity make it an essential component in many scientific experiments and studies.
ACTH antibody
Adrenocorticotropic Hormone antibody was raised in rabbit using synthetic ACTH as the immunogen.Degré de pureté :Min. 95%PERK antibody
The PERK antibody is a polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the activated form of PERK (protein kinase RNA-like endoplasmic reticulum kinase). This monoclonal antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
ZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen
Degré de pureté :Min. 95%Bbs1 antibody
Bbs1 antibody was raised in rabbit using the N terminal of Bbs1 as the immunogen
Degré de pureté :Min. 95%ANTP antibody
ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
