Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
proBNP antibody
The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.
WTAP antibody
The WTAP antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of Life Sciences. It acts as an inhibitory factor, blocking specific protein interactions and pathways. This antibody is produced using state-of-the-art technology and is free from any harmful excipients.
Chlamydia trachomatis antibody (FITC)
Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.
CDK2 antibody
The CDK2 antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been found to be effective in inhibiting the growth of hepatocyte, promoting natriuretic activity, and regulating fibrinogen activation. The CDK2 antibody is also known for its histidine glycosylation properties, which enhance its stability and binding affinity. Additionally, this antibody has been used in the detection and quantification of autoantibodies and steroids. With its high specificity and reliability, the CDK2 antibody is a valuable tool for researchers in need of accurate and precise measurements in their studies.
Fibrinopeptide A antibody
Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.
CD19 antibody (Spectral Red)
CD19 antibody (Spectral Red) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molUBXN6 antibody
UBXN6 antibody was raised in rabbit using the C terminal of UBXN6 as the immunogen
Degré de pureté :Min. 95%DONSON antibody
DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
NR0B1 antibody
NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC
Influenza A antibody
Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.
NGAL antibody
The NGAL antibody is a powerful tool in the field of Life Sciences. It is an adeno-associated antibody that specifically targets and neutralizes the activity of tyrosine, TNF-α, and other activated molecules. This antibody has been extensively studied and proven to be highly effective in various research applications.
KLC3 antibody
KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
PDE3B antibody
PDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVNDegré de pureté :Min. 95%Donkey anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.
Degré de pureté :Min. 95%NOTCH3 antibody
The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
FBXO18 antibody
FBXO18 antibody was raised in mouse using recombinant Human F-Box Protein, Helicase, 18 (Fbxo18)Cystatin C antibody
Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.
