Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
ICAM1 antibody
ICAM1 antibody was raised in Mouse using a purified recombinant fragment of human ICAM1(28-480aa) expressed in E. coli as the immunogen.Goat anti Rat IgM (FITC)
Goat anti-rat IgM (FITC) was raised in goat using rat IgM mu chain as the immunogen.
Degré de pureté :Min. 95%ZNF419A antibody
ZNF419A antibody was raised in rabbit using the C terminal of ZNF419A as the immunogen
Degré de pureté :Min. 95%Goat anti Rabbit IgG (H + L) (Alk Phos)
Goat anti-rabbit IgG (H + L) (Alk Phos) was raised in goat using rabbit IgG whole molecule as the immunogen.Degré de pureté :Min. 95%RNF19A antibody
RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Degré de pureté :Min. 95%MAP2 antibody
The MAP2 antibody is a growth factor antagonist that binds to specific proteins in order to inhibit their activity. It is a monoclonal antibody, meaning it is produced from a single clone of cells and is highly specific in its binding properties. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
