Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
NUDT21 antibody
NUDT21 antibody was raised in mouse using recombinant Human Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 21 (Nudt21)RPN2 antibody
The RPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications to study insulin and its related functions. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most appropriate option for their specific needs.
EIF4H antibody
EIF4H antibody was raised using the C terminal of EIF4H corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE
RBMS2 antibody
RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNRP11-78J21.1 antibody
RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNPDE3B antibody
The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.
Cytochrome P450 2D6 antibody
The Cytochrome P450 2D6 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize the activity of the Cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism and can affect the efficacy and safety of various medications.Calicin antibody
Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNASTAG2 antibody
The STAG2 antibody is a polypeptide used in Life Sciences research. It is a polyclonal antibody that specifically targets the STAG2 antigen. This antibody is commonly used in studies involving nucleic acids and can be used to detect and analyze various nucleic acid molecules. Its high specificity and sensitivity make it an essential tool for researchers working in the field of molecular biology and genetics. With its wide range of applications, the STAG2 antibody is a valuable asset for any laboratory or research facility.
Carbonic Anhydrase IV antibody
Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFTECK antibody
TECK antibody was raised in mouse using highly pure recombinant human TECK as the immunogen.BECN1 antibody
The BECN1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor-like domain of BECN1. It has been shown to neutralize the activity of TNF-α, a pro-inflammatory cytokine involved in various diseases. This specific antibody can inhibit the binding of TNF-α to its receptor and prevent downstream signaling pathways associated with inflammation. In addition, the BECN1 antibody has been found to block the interaction between growth factors and fibronectin, inhibiting cell migration and proliferation. It also shows potential in modulating chemokine expression and regulating TGF-beta signaling. With its wide range of applications in life sciences, this antibody holds promise for research and therapeutic purposes in collagen-related diseases and other inflammatory conditions.CCNB1 antibody
CCNB1 antibody was raised in Mouse using a purified recombinant fragment of human CCNB1 expressed in E. coli as the immunogen.NGAL antibody
The NGAL antibody is a monoclonal antibody that is commonly used in scientific research and medical diagnostics. It is designed to specifically bind to neutrophil gelatinase-associated lipocalin (NGAL), an anti-apoptotic protein that is involved in various physiological processes.NGAL antibody
The NGAL antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is an important biomarker for various diseases, including helicobacter infection and kidney injury. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA. Its high specificity and affinity make it an ideal choice for researchers studying the role of NGAL in disease progression and therapeutic interventions. With its ability to bind to NGAL with high precision, this antibody opens up new possibilities for understanding the complex mechanisms underlying chemokine signaling and endothelial growth factor regulation. Whether you are working in academia or industry, the NGAL antibody will undoubtedly enhance your research capabilities and contribute to advancements in the field.DHX35 antibody
DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQRBBP7 antibody
The RBBP7 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor and has been extensively used in various applications such as immunoassays, immunofluorescence, and Western blotting. This antibody has shown high affinity and specificity for its target, making it an essential tool for studying cellular processes involving the epidermal growth factor pathway.STRAP antibody
STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL
