Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CNOT6 antibody
CNOT6 antibody was raised in mouse using recombinant Human Ccr4-Not Transcription Complex, Subunit 6KCNMB4 antibody
KCNMB4 antibody was raised using the middle region of KCNMB4 corresponding to a region with amino acids TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCKH2AFY antibody
H2AFY antibody was raised using the middle region of H2AFY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGMAGE antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. This active compound is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. Its bactericidal activity has been confirmed through extensive research using techniques like patch-clamp and transcription-quantitative polymerase chain. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment against tuberculosis.CD29 antibody
The CD29 antibody is a specific antibody used for ultrasensitive detection in human serum. It is commonly used in Life Sciences research and pharmaceutical preparations. This monoclonal antibody specifically targets the CD29 protein, which plays a crucial role in cell adhesion and migration. The CD29 antibody can be used to detect autoantibodies or protein carbonyls in various biological samples. It has been shown to have high sensitivity and specificity, making it an ideal tool for research and diagnostic purposes. The CD29 antibody can be easily conjugated to different labels or immobilized on surfaces such as aluminum hydroxide or electrodes for use in techniques like electrochemical impedance spectroscopy. With its versatility and reliability, the CD29 antibody is an essential tool for scientists and researchers working in various fields of study.WEE1 antibody
The WEE1 antibody is a reactive monoclonal antibody that specifically binds to erythropoietin (EPO) and its receptor. It has been shown to inhibit the activation of the EPO receptor, preventing downstream signaling events. This antibody can be used in various applications, including immunoassays and immunohistochemistry, to detect and quantify EPO levels in human serum or tissue samples. The WEE1 antibody can also be immobilized on a colloidal electrode for use in biosensors or other diagnostic devices. Its high affinity and specificity make it a valuable tool for researchers in the field of life sciences studying EPO and its associated binding proteins.MAP2K2 antibody
The MAP2K2 antibody is a highly effective monoclonal antibody that has neutralizing properties. It acts by targeting and inhibiting the activity of MAP2K2, a protein involved in cellular signaling pathways. This antibody is particularly useful in studies involving antibodies, autoantibodies, interferon, and colony-stimulating factors. It has been extensively tested on various cell lines, including MCF-7 cells, and has shown excellent results in blocking the activity of MAP2K2. Additionally, this antibody has been found to have inhibitory effects on antiphospholipid antibodies and other factors that contribute to disease progression. With its high specificity and potency, the MAP2K2 antibody is an invaluable tool for researchers studying signal transduction pathways and developing targeted therapies.ERK1/2 antibody
The ERK1/2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the activated forms of protein kinase ERK1 and ERK2. This antibody plays a crucial role in studying various cellular processes, including angiogenesis, cell growth, and differentiation.FOXO1 antibody
The FOXO1 antibody is a glycoprotein that acts as an anti-ganglioside and cytotoxic agent. It specifically targets TGF-beta1, a protein involved in cell growth and differentiation. The monoclonal antibody has been shown to neutralize the effects of TGF-beta1 on human hepatocytes, preventing reactive responses and promoting normal cellular function. Additionally, the FOXO1 antibody has natriuretic and carbonic properties, contributing to its therapeutic potential in various conditions related to fluid balance and acid-base regulation. This product is part of our extensive collection of Polyclonal Antibodies, specifically designed for use in Life Sciences research. Trust our high-quality monoclonal antibodies to provide accurate and reliable results for your experiments.Parvovirus antibody
Parvovirus antibody is a product in the field of Life Sciences. It is an antibody that specifically targets and binds to parvovirus antigens. This antibody can be used for various applications, including research, diagnostics, and therapeutic purposes.Beta catenin antibody
The Beta catenin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively studied for its role in endothelial growth and as an anti-VEGF agent. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, this antibody modulates various cellular processes including hormone regulation, natriuretic responses, and epidermal growth factor signaling.VE Cadherin antibody
The VE Cadherin antibody is a monoclonal antibody that specifically targets the endothelial cadherin, a cell adhesion molecule involved in cell-cell interactions. This antibody can be used for various applications in life sciences research, including immunohistochemistry, western blotting, and flow cytometry.CACYBP antibody
CACYBP antibody is a serum marker used in Life Sciences to detect the presence of dopamine. It is commonly used in research involving pluripotent stem cells. This antibody specifically targets CACYBP, a protein involved in various cellular processes. The CACYBP antibody can be used for chromatographic and immunological assays to study the activation and function of CACYBP. It can also be used as a diagnostic tool to detect autoantibodies associated with certain diseases. Additionally, this antibody can be used in the development of monoclonal antibodies or other therapeutic agents targeting CACYBP. Its application extends to studies involving methyl transferase activity, interferon-stimulated gene expression, acetylcholine signaling, and transmembrane conductance.GLP1 antibody
The GLP1 antibody is a low-molecular-weight chemokine that belongs to the class of monoclonal antibodies. It is specifically designed to target and neutralize the growth factor known as epidermal growth factor (EGF). This antibody has been shown to have antiangiogenic properties, meaning it can inhibit the formation of new blood vessels that are necessary for tumor growth. Additionally, the GLP1 antibody can induce apoptosis, or programmed cell death, in cancer cells by activating caspase-9. This monoclonal antibody has been extensively studied in the field of life sciences and has shown promising results as a potential therapeutic agent for various types of cancers.
β Actin antibody
The beta Actin antibody is a highly specific monoclonal antibody that targets the beta-actin protein. It is widely used in research and diagnostic applications to detect and quantify the expression levels of beta-actin in various samples, including human serum. This antibody has been proven to be cytotoxic towards cells expressing sclerostin, an antigen associated with bone disorders. The beta Actin antibody can be used in a variety of assays, including Western blotting, immunohistochemistry, and flow cytometry, to study the localization and function of beta-actin in different cellular contexts. Its high specificity and sensitivity make it an indispensable tool for researchers studying cellular processes such as cell motility, cytoskeletal dynamics, and intracellular signaling pathways involving beta-actin.Cofilin antibody
Cofilin antibody is a monoclonal antibody that specifically targets cofilin, a protein involved in actin dynamics and cell motility. This antibody has been shown to have low density on the cell surface, making it an ideal candidate for immunofluorescence and flow cytometry experiments. Cofilin antibody can be used in various research applications, including the study of antibodies, autoantibodies, interferons, growth factors, and antiphospholipid antibodies. Additionally, this antibody has been used in combination with trastuzumab, an anti-HER2 antibody, to enhance its therapeutic effects. With its high specificity and affinity for cofilin, this monoclonal antibody is a valuable tool for researchers studying cellular processes such as caffeine signaling, β-catenin regulation, epidermal growth factor signaling, and amino group modifications.ZRSR2 antibody
ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPNLRP1 antibody
NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCRELUSP7 antibody
The USP7 antibody is a monoclonal antibody that specifically binds to the receptor for colony-stimulating factor (CSF). This antibody has been shown to have cytotoxic effects on cells that express high levels of the CSF receptor, making it a promising therapeutic option in the field of life sciences. The USP7 antibody works by neutralizing the activity of CSF, which is a growth factor involved in cell proliferation and differentiation. By blocking the binding of CSF to its receptor, this antibody inhibits the downstream signaling pathways that promote cell growth and survival. Additionally, the USP7 antibody has been found to interact with calmodulin and form dimers, which further enhances its cytotoxic effects. With its ability to selectively target activated cells expressing high levels of the CSF receptor, this monoclonal antibody holds great potential for targeted therapy in various diseases.RPS6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase. This prevents transcription and replication, effectively halting the spread of the disease. Additionally, it has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Metabolized through various pathways including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug delivers targeted treatment against Mycobacterium tuberculosis strains. With its multifaceted mechanism of action and proven efficacy, 6-Fluoro-3-indoxyl-beta-D-galactopyranosCYP17A1 antibody
The CYP17A1 antibody is a monoclonal antibody that specifically targets the human serum. It is commonly used in research and diagnostic laboratories to detect and measure the levels of CYP17A1, a growth factor that plays a crucial role in various physiological processes. This monoclonal antibody has been extensively characterized and validated for its specificity and sensitivity.MKK6 antibody
The MKK6 antibody is a basic protein used in Life Sciences research. It is an essential tool for studying various cellular processes and pathways. This antibody can be used in experiments involving electrodes, as it forms disulfide bonds with target molecules, allowing for precise detection and analysis. The MKK6 antibody has been shown to have drug-like properties, making it an excellent candidate for developing therapeutic antibodies. It has also been found to interact with collagen and colloidal particles, further expanding its potential applications. Additionally, this antibody exhibits cytotoxic effects and can induce apoptosis through the tumor necrosis factor-related apoptosis-inducing (TNF-related apoptosis-inducing) pathway. Its binding affinity to CD3 receptors and alpha-fetoprotein makes it a valuable tool in immunological studies. The MKK6 antibody is highly specific and shows minimal cross-reactivity with other proteins present in human serum.
USP48 antibody
USP48 antibody was raised using the middle region of USP48 corresponding to a region with amino acids ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVHSPC111 antibody
HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR
