Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
RNASEH2A antibody
RNASEH2A antibody was raised using the middle region of RNASEH2A corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLETIMP1 monoclonal antibody
The TIMP1 monoclonal antibody is a highly specialized antibody that specifically targets and neutralizes the activity of tissue inhibitor of metalloproteinase 1 (TIMP1). TIMP1 is a protein involved in various biological processes, including dopamine regulation, adiponectin signaling, and chemokine activity.PAOX antibody
PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL
STRAP antibody
The STRAP antibody is a highly specialized antibody used in the field of Life Sciences. It is specifically designed to target and bind to colony-stimulating factors (CSFs), which are proteins responsible for stimulating the production and differentiation of immune cells, particularly macrophages. This polyclonal antibody is derived from human serum and contains a high concentration of CSF-binding antibodies.PSMA4 antibody
The PSMA4 antibody is a monoclonal antibody that has cytotoxic properties. It specifically targets the PSMA4 protein, which is found in the nucleus of cells. This antibody can be used for various biochemical and life science applications, including research and diagnostic purposes. It has been shown to interact with other proteins such as fibrinogen and elastase, making it a valuable tool for studying protein-protein interactions. Additionally, the PSMA4 antibody has been used in electrode-based assays to detect and quantify specific proteins in samples. Its high specificity and affinity make it an ideal choice for researchers working in the field of molecular biology and immunology.SNAI1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.BNP antibody
BNP antibody was raised in mouse using human BNP or synthetic BNP peptide conjugated with carrier protein as the immunogen.PSD3 antibody
PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQMERTK antibody
The MERTK antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the MERTK protein, which plays a crucial role in various cellular processes. This antibody is widely used in studies related to collagen, blood plasma, interferon, and platelet-derived growth factor-bb.
LAT3 antibody
LAT3 antibody is a monoclonal antibody that is used as a medicament in the field of Life Sciences. It specifically targets arginase, an enzyme involved in the metabolism of arginine. By blocking the activity of arginase, LAT3 antibody helps to regulate the levels of arginine in the body, which can have various biochemical effects. This antibody has been extensively studied and characterized using hybridoma cell lines and isolated nucleic acids. It has shown high affinity for its target and exhibits excellent specificity for human proteins. LAT3 antibody is widely used in research laboratories and pharmaceutical companies for a variety of applications, including protein analysis, immunohistochemistry, and drug development. Whether you need a monoclonal or polyclonal antibody, LAT3 antibody is a reliable choice that delivers consistent results.Raf1 antibody
The Raf1 antibody is a polyclonal antibody that specifically targets the Raf1 protein. It is commonly used in the field of life sciences for research purposes. The Raf1 protein plays a crucial role in cell signaling pathways, particularly in the regulation of cell growth and differentiation. This antibody can be used to detect and quantify the expression levels of Raf1 in various samples, such as serum or tissue extracts. It is highly specific and sensitive, making it a valuable tool for studying the function and activity of Raf1 in different biological processes. Researchers often rely on this antibody to investigate the involvement of Raf1 in diseases like cancer, cardiovascular disorders, and neurological conditions. Its high affinity for the target antigen ensures accurate and reliable results, making it an essential component in many scientific studies.
BAK1 antibody
BAK1 antibody was raised in mouse using recombinant human BAK1 (29-187aa) purified from E.coli as the immunogen.SOX17 antibody
The SOX17 antibody is a highly specialized monoclonal antibody that targets the HER2 protein. It works by binding to β-catenin, a protein involved in cell signaling pathways, and inhibiting its function. This antibody has been extensively tested and has shown excellent results in low-density lipoprotein (LDL) receptor-deficient mice. Additionally, it has been found to have synergistic effects when used in combination with other therapeutic agents such as interferon, caffeine, transferrin, and trastuzumab.Hamster RBC antibody (FITC)
Hamster RBC antibody (FITC) was raised in rabbit using hamster erythrocytes as the immunogen.
KCTD10 antibody
KCTD10 antibody was raised using the middle region of KCTD10 corresponding to a region with amino acids EETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRIDesmoglein 1 antibody
Desmoglein 1 antibody was raised in mouse using recombinant human polypeptide Desmoglein 1 as the immunogen.TAF7L antibody
TAF7L antibody was raised using a synthetic peptide corresponding to a region with amino acids QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQSFRS7 antibody
SFRS7 antibody was raised using the middle region of SFRS7 corresponding to a region with amino acids SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPHaemoglobin antibody
The Haemoglobin antibody is a monoclonal antibody that specifically targets human serum. It is widely used in research and diagnostic applications, particularly in the field of mass spectrometry. This monoclonal antibody has been developed using advanced techniques and exhibits high specificity and affinity for its target. It can be used in various immunoassays, such as ELISA and Western blotting, to detect and quantify haemoglobin levels accurately. Additionally, this antibody has shown potential therapeutic applications, including neutralizing the effects of certain glycoproteins and proteolytic enzymes. Its unique properties make it a valuable tool for studying haemoglobin-related disorders and developing targeted treatments.TIM antibody
The TIM antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, which plays a crucial role in cell proliferation and differentiation. The TIM antibody can be used in research related to heparin-induced thrombocytopenia, where it helps in identifying and studying the mechanisms involved in this condition.
