Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
PNMAL1 antibody
PNMAL1 antibody was raised using the middle region of PNMAL1 corresponding to a region with amino acids APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ
Melanopsin antibody
The Melanopsin antibody is a growth factor that targets amyloid plaque, annexin, adipose, and epidermal growth factor proteins. It is a highly specific monoclonal antibody that can be used for various applications in Life Sciences research. This antibody has the ability to detect autoantibodies and polyclonal antibodies in samples, making it an essential tool for immunological studies. It has been tested and validated to ensure high specificity and sensitivity. The Melanopsin antibody is free from contaminants such as circovirus, mycoplasma genitalium, and hemolysis, ensuring reliable results in experiments. Trust this antibody to provide accurate and reproducible data for your research needs.Goat anti Pig IgG (H + L) (biotin)
Goat anti-pig IgG (H + L) (biotin) was raised in goat using porcine IgG, (H & L) as the immunogen.AXUD1 antibody
AXUD1 antibody was raised in rabbit using human AXUD1 protein as the immunogen.Degré de pureté :Min. 95%RPLP0 antibody
RPLP0 antibody was raised using the N terminal of RPLP0 corresponding to a region with amino acids TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTARID3C antibody
ARID3C antibody was raised in rabbit using the C terminal of ARID3C as the immunogenDegré de pureté :Min. 95%STAT1 antibody
The STAT1 antibody is a highly effective monoclonal antibody that has antiviral properties. It specifically targets and binds to the STAT1 protein, which plays a crucial role in the immune response against viral infections. This antibody can neutralize the activity of the STAT1 protein, preventing it from activating genes involved in viral replication.KLHDC9 antibody
KLHDC9 antibody was raised using the middle region of KLHDC9 corresponding to a region with amino acids AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSCNMUR2 antibody
NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSVFentanyl Antibody
The Fentanyl antibody is an acidic antibody that has been specifically designed for use in Life Sciences research. It is a monoclonal antibody that binds to the chemokine receptor CXCR4, which plays a crucial role in various physiological and pathological processes. This antibody can be used for immunohistochemistry experiments to detect the presence of CXCR4 in human hepatocytes or other relevant cell types. The Fentanyl antibody has been shown to have high affinity and specificity for its target antigen, making it a valuable tool for researchers studying the function and regulation of CXCR4. Additionally, this antibody can be used in combination with other binding proteins or antibodies to investigate complex cellular interactions or as part of cytotoxic assays.mTOR antibody
The mTOR antibody is a cytotoxic monoclonal antibody that targets the mammalian target of rapamycin (mTOR) pathway. It is used in life sciences research to study cell growth, proliferation, and survival. The mTOR antibody neutralizes the activity of mTOR by binding to its receptor and preventing downstream signaling. This antibody has been shown to inhibit the formation of mTOR dimers, which are essential for its activation. Additionally, it acts as a colony-stimulating factor by promoting the growth of specific cell types. The mTOR antibody also interacts with calmodulin and phosphatase enzymes, further modulating cellular processes. Researchers use this antibody in various applications such as Western blotting, immunohistochemistry, and flow cytometry to investigate the role of mTOR in different biological systems.SARS2 antibody
The SARS2 antibody is a monoclonal antibody that specifically targets the SARS-CoV-2 virus. It works by binding to the amino group of the virus, preventing its endocytic uptake into host cells. This antibody has shown promising results in inhibiting viral replication and reducing the severity of COVID-19 symptoms.BMI1 antibody
The BMI1 antibody is a polyclonal antibody that specifically targets the BMI1 protein, which is involved in granulosa cell growth and acts as a transcriptional repressor. This antibody has been shown to be reactive against the amino group of BMI1 and can be used for various applications such as immunohistochemistry, Western blotting, and ELISA. It can also be used for studying the role of BMI1 in different cellular processes and pathways. Additionally, this antibody has been found to interact with other proteins such as E-cadherin and interleukin-6, making it a valuable tool for research in multiple fields.
FYN antibody
FYN antibody was raised using the middle region of FYN corresponding to a region with amino acids CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENDegré de pureté :Min. 95%Donkey anti Rat IgG (H + L) (Fab'2) (PE)
Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using rat IgG (H&L) as the immunogen.ISCA2 antibody
ISCA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY
SOX17 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Gastrin antibody
The Gastrin antibody is a monoclonal antibody that specifically targets messenger RNA (mRNA) and plays a crucial role in regulating the production of gastrin. Gastrin is a hormone that stimulates the release of gastric acid, making it an essential component in digestive processes. The Gastrin antibody can be used in various applications, including solid-phase assays and quantitation of gastrin levels.CA13 antibody
The CA13 antibody is a highly specialized polyclonal antibody that has the ability to neutralize dopamine, a neurotransmitter in the brain. This antibody specifically targets and binds to the nuclear receptor responsible for dopamine regulation, effectively blocking its activity. Additionally, the CA13 antibody has been shown to inhibit the production of interferon and interleukin-6, two key players in the immune response.RGS13 antibody
RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
TREM1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This active compound has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid, it exhibits high efficacy against Mycobacterium tuberculosis strains. If you're looking for an effective treatment for tuberculosis, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is your best bet.Progerin Antibody
The Progerin Antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and bind to progerin, a protein associated with accelerated aging. Through its unique mechanism of action, the Progerin Antibody inhibits the harmful effects of progerin on cellular processes.CPSF4 antibody
CPSF4 antibody was raised using the C terminal of CPSF4 corresponding to a region with amino acids SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKVimentin antibody
The Vimentin antibody is a powerful tool for research in various fields. It is a monoclonal antibody that specifically targets vimentin, a protein involved in cell structure and movement. This antibody can be used to study the role of vimentin in different cellular processes, such as cell migration, invasion, and metastasis.
