Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Human Serum Albumin antibody
Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.Cytokeratin 18 antibody
The Cytokeratin 18 antibody is a specific antibody used in Life Sciences research. It is commonly used to detect and measure the levels of Cytokeratin 18, a protein that is found in epithelial cells. This antibody can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting. It has been shown to have high affinity and specificity for Cytokeratin 18, making it a valuable tool for studying the function and expression of this protein. The Cytokeratin 18 antibody can also be used to study diseases such as cancer, where abnormal levels of Cytokeratin 18 may be present. Overall, this antibody is an essential tool for researchers working in the field of Life Sciences.anti-Canine Heartworm Monoclonal
Purified anti-Canine Heartworm Monoclonal AntibodyDegré de pureté :Min. 95%anti-Human Troponin I Monoclonal Antibody
Monoclonal Mouse anti-Human Cardiac Troponin IDegré de pureté :Min. 95%anti-Carcinoembryonic Antigen (CEA) Monoclonal
Carcinoembryonic antigen (CEA) is a tumor-specific antigen overexpressed in multiple cancers.Degré de pureté :Min. 95%anti-Epididymis Protein 4 (HE4) Monoclonal
Purified anti-Epididymis Protein 4 (HE4) Monoclonal AntibodyDegré de pureté :Min. 95%anti-Human CA-125 Monoclonal Antibody
Purified Mouse anti-Human Cancer Antigen 125 (CA-125) Antibody.Degré de pureté :Min. 95%Luteinizing Hormone beta antibody (HRP)
Luteinizing hormone beta antibody (HRP) was raised in mouse using human LH beta subunit as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molMHC Class I antibody (FITC)
MHC Class I antibody (FITC) was raised in mouse using human HSB-2 T cell line as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molMouse anti Rat κ 1 Light Chain (HRP)
Mouse anti-rat kappa 1 light chain (HRP) was raised in mouse using rat kappa-L chain as the immunogen.Degré de pureté :Min. 95%Rat anti Mouse IgG1 Heavy Chain (biotin)
Mouse IgG1 heavy chain antibody (biotin) was raised in rat using murine IgG1 as the immunogen.Degré de pureté :Min. 95%Masse moléculaire :0 g/molHuman Albumin antibody
human Albumin antibody was raised in goat using Purified human Albumin as the immunogen.
ApoA-II antibody
ApoA II antibody was raised in goat using Human Apolipoprotein AII as the immunogen.
hCG antibody (Ascites)
Please enquire for more information about hCG antibody (Ascites) including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%Legionella Species Rabbit Polyclonal Antibody, IgG Fraction
Legionella Species Rabbit Polyclonal Anitbody, IgG Fraction is a life science tool for use in IVD applications. Please enquire for more information about Legionella Species Rabbit Polyclonal Anitbody, IgG Fraction including the price, delivery time and more detailed product information at the technical inquiry form on this page.IL4 antibody
The IL4 antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets and neutralizes interferon-gamma (IFN-gamma), a cytokine involved in immune responses. This antibody has been shown to have intraocular effects, particularly in the context of endothelial growth and autoantibodies. Additionally, it has been found to inhibit the activity of growth factors such as acetylcholine and chemokines. The IL4 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. With its ability to target and neutralize key molecules involved in immune responses, this antibody is an invaluable tool for studying the intricate workings of the immune system.BAD antibody
The BAD antibody is a globulin found in human serum that is commonly used in Life Sciences research. This antibody has shown promising potential as an anticancer agent and is widely used in the development of targeted therapies. It specifically targets and binds to adipose tissue, making it a valuable tool for studying adipose-related diseases and disorders. The BAD antibody has also been used to detect bovine γ-globulin, chemokine-activated cells, and reactive molecules involved in various molecular signaling pathways. Additionally, this antibody has demonstrated cytotoxic effects against certain cancer cells and has been utilized in studies investigating the therapeutic properties of compounds such as icariin and paliperidone. With its versatility and wide range of applications, the BAD antibody is an essential component in many research endeavors within the field of Life Sciences.GST antibody
The GST antibody is a specific monoclonal antibody that recognizes and binds to the glutathione S-transferase (GST) protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. The GST antibody has high affinity and specificity for GST, making it an excellent tool for detecting and quantifying GST-tagged proteins in various samples.MIF antibody
The MIF antibody is a highly specialized cytotoxic agent that specifically targets and neutralizes the inhibitory factor known as Macrophage Migration Inhibitory Factor (MIF). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.HMGCS2 antibody
HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQECSTF2T antibody
CSTF2T antibody was raised using the C terminal of CSTF2T corresponding to a region with amino acids MRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQMCM2 antibody
MCM2 antibody was raised using the N terminal of MCM2 corresponding to a region with amino acids PGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDGEELIGDGMCD226 antibody
The CD226 antibody is a highly sensitive monoclonal antibody that is used for the detection of acidic cysteine disulfide natriuretic peptides. It specifically targets the primary amino acid sequence of CD226 in human serum, making it an essential tool for researchers in the field of life sciences. This antibody can be used in various applications, including ultrasensitive detection assays and electrode-based immunoassays. Additionally, it has potential as a blood biomarker for the diagnosis and monitoring of certain diseases. The CD226 antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific experimental needs. With its high specificity and sensitivity, this antibody is a valuable asset in the study of CD226 and its role as an inhibitory factor in various biological processes.CCDC46 antibody
CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDAnti-CDV antibody
The Anti-CDV antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the antigen nuclear sclerostin, which is involved in bone metabolism. This antibody has been extensively studied and has shown high affinity for its target. It can be used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting. The Anti-CDV antibody has also been explored as a potential therapeutic agent due to its cytotoxic properties. In addition, it can be conjugated with drugs to create antibody-drug conjugates for targeted therapy. Researchers and scientists rely on this monoclonal antibody to study and understand the role of sclerostin in bone health and disease progression.BPGM antibody
BPGM antibody was raised using the C terminal of BPGM corresponding to a region with amino acids LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK
S6K1 antibody
The S6K1 antibody is a monoclonal antibody used in Life Sciences. It acts as an anticoagulant by neutralizing the binding proteins involved in blood clotting. This antibody targets specific glycosylation sites on activated proteins, preventing them from forming clots. In addition to its anticoagulant properties, the S6K1 antibody can also be used in research and diagnostic applications. It has been shown to inhibit the activity of colony-stimulating factors and interleukin-6, which are involved in inflammation and immune responses. Furthermore, this antibody has demonstrated its ability to bind to fibrinogen and glycopeptides, providing insights into their structure and function. While it offers numerous benefits, it is important to note that the S6K1 antibody should be handled with care due to its potential toxic effects. For researchers and scientists seeking reliable antibodies for their experiments, the S6K1 antibody is a valuable tool in understanding various biological processes and pathways.ITGA5 antibody
The ITGA5 antibody is a growth factor antibody that plays a crucial role in the field of Life Sciences. It specifically targets and neutralizes interleukin-6 (IL-6), an important cytokine involved in various physiological processes. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments.PFN1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is highly active in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, demonstrating its high efficacy. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
