Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
PCBP1 antibody
PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFUPF3A antibody
UPF3A antibody was raised using a synthetic peptide corresponding to a region with amino acids QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGSNAP25 antibody
The SNAP25 antibody is a polyclonal antibody that specifically targets the SNAP25 protein. This protein plays a crucial role in synaptic vesicle exocytosis and neurotransmitter release, making it an essential component in neuronal communication. The SNAP25 antibody is widely used in life sciences research to study the function and regulation of this protein.RWDD2A antibody
RWDD2A antibody was raised using the N terminal of RWDD2A corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVAGM2A antibody
GM2A antibody was raised using the N terminal of GM2A corresponding to a region with amino acids SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLCD205 antibody
The CD205 antibody is a highly specialized test compound used in various research applications. It is a monoclonal antibody that specifically targets CD205, a protein expressed on the surface of certain cells. This antibody has been extensively studied and proven to be effective in detecting and analyzing CD205 expression.PPM1A antibody
The PPM1A antibody is a highly specific monoclonal antibody that targets the protein phosphatase 1A (PPM1A). This antibody has been extensively used in various research fields, including Life Sciences and Biotechnology. It has shown great potential in studying the role of PPM1A in different cellular processes.PLAU antibody
The PLAU antibody is a monoclonal antibody that specifically targets the PLAU protein. This protein plays a crucial role in various biological processes, including cell migration, tissue remodeling, and angiogenesis. The PLAU antibody has been extensively studied and shown to have high affinity and specificity for its target.MGC87631 antibody
MGC87631 antibody was raised using the middle region of MGC87631 corresponding to a region with amino acids VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTVRAB3IL1 antibody
RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHDDX1 antibody
DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGADAPP1 antibody
DAPP1 antibody was raised using the middle region of DAPP1 corresponding to a region with amino acids KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDEzrin antibody
The Ezrin antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of Ezrin protein. This antibody has been extensively studied in various research fields, including Life Sciences and Antibodies. It has shown remarkable efficacy in inhibiting the interaction between Ezrin and its binding partners, such as fibrinogen, leading to the disruption of important cellular processes.CKMB Antibody
CKMB Antibody is a monoclonal antibody that specifically targets creatine kinase MB (CK-MB), an enzyme found in the heart muscle. This antibody is widely used in the field of Life Sciences for various applications, including research and diagnostic purposes. CKMB Antibody has high affinity and specificity towards CK-MB, making it an ideal tool for detecting and quantifying CK-MB levels in biological samples. It can be used in immunoassays such as ELISA or Western blotting to accurately measure CK-MB concentrations. Additionally, this antibody has been utilized in the development of ophthalmic formulations and has shown potential therapeutic applications in targeting chemokines and tumor necrosis factor-alpha (TNF-α). With its exceptional binding properties and versatility, CKMB Antibody plays a crucial role in advancing scientific understanding of biomolecules and their interactions, paving the way for innovative research breakthroughs in the field of Life Sciences.Thrombin antibody (HRP)
Thrombin antibody (HRP) was raised in sheep using Thrombin prepared from purified rabbit Prothrombin as the immunogen.CX36 antibody
CX36 antibody was raised using the middle region of Cx36 corresponding to a region with amino acids NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNALKB1 antibody
The LKB1 antibody is a monoclonal antibody that plays a crucial role in inhibiting the growth factor signaling pathway. It is water-soluble and specifically targets enteroendocrine cells, which are responsible for regulating glucose homeostasis and insulin secretion. This antibody has shown promising results in reducing amyloid plaque formation in Alzheimer's disease models, making it a potential therapeutic option for treating this neurodegenerative disorder. Additionally, the LKB1 antibody has cytotoxic effects on cancer cells by inhibiting endothelial cell growth and disrupting tumor angiogenesis. It can be used as a research tool in various life sciences studies, including investigating dopamine signaling pathways and assessing microvessel density. With its neutralizing properties, this mouse monoclonal antibody is highly valuable for both basic research and potential therapeutic applications.
RAD17 antibody
The RAD17 antibody is a highly specialized inhibitor used in Life Sciences research. It targets the RAD17 protein, which plays a crucial role in DNA repair and cell cycle regulation. This antibody is commonly used in assays to study the function of RAD17 and its interactions with other proteins involved in DNA damage response pathways. The RAD17 antibody is a polyclonal antibody, meaning it is produced by multiple clones of B cells and can recognize different epitopes on the target protein. Its high specificity makes it an ideal tool for studying the effects of RAD17 inhibition on various cellular processes. Researchers also use this antibody to investigate the potential therapeutic applications of targeting RAD17 in diseases such as cancer. With its exceptional binding affinity and selectivity, the RAD17 antibody offers valuable insights into the intricate mechanisms underlying DNA repair and genome stability.RP2 antibody
RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGFilaria Antibody
Filaria Antibody is a highly effective and specialized medication that targets specific antibodies, including anti-cd25 antibody drugs. It falls under the category of histone deacetylase inhibitors and is known for its potent amide and heteroaromatic properties. Developed for use in the field of Life Sciences, this monoclonal antibody has been extensively tested and proven to be highly activated against filaria infections.STAU1 antibody
STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG
TTF1 antibody
The TTF1 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It is designed to target and bind to the thyroid transcription factor 1 (TTF1), which plays a crucial role in regulating the expression of genes involved in cholinergic signaling and glycan synthesis. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.
