Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
RPL13 antibody
RPL13 antibody was raised using the C terminal of RPL13 corresponding to a region with amino acids KKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKKInfluenza A antibody (H3N2) (biotin)
Influenza A antibody (H3N2) (biotin) was raised in goat using influenza A, strain Texas 1/77 (H3N2) as the immunogen.α enolase antibody
The Alpha enolase antibody is a powerful tool used in Life Sciences research. It is a Polyclonal Antibody that specifically targets the alpha enolase protein. This antibody is widely used in various applications, including immunohistochemistry, western blotting, and ELISA.STAT5 antibody
The STAT5 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used for research purposes and is particularly effective in studying the signaling pathways involving trastuzumab, epidermal growth factor, and growth factor-1 receptor. This antibody specifically targets STAT5, a transcription factor that plays a crucial role in cell growth and differentiation.SERPINB2 antibody
The SERPINB2 antibody is a monoclonal antibody that is used in mass spectrometric methods to detect and study inhibitors of serine proteases. It specifically targets SERPINB2, a protein complex involved in regulating the activity of serine proteases. This antibody can be used in various life sciences research applications, including the study of nuclear extracts and the detection of autoantibodies. Additionally, it has been shown to inhibit the growth factor signaling pathway and act as a kinase inhibitor. The SERPINB2 antibody is a valuable tool for researchers in the field of protein analysis and characterization.BAFF antibody
BAFF antibody was raised in mouse using highly pure recombinant human BAFF as the immunogen.Borrelia burgdorferi Ab
Borrelia burgdorferi Ab is an amide that acts as a chemokine in the human body. It has been extensively studied in Life Sciences for its role in various processes. This compound has shown to be nephrotoxic and can be detected in human serum using Monoclonal Antibodies. Borrelia burgdorferi Ab has also been associated with the production of autoantibodies and the regulation of TGF-beta. Furthermore, it has shown cytotoxic effects on certain cells and has been studied for its potential therapeutic applications. The use of monoclonal antibodies targeting Borrelia burgdorferi Ab has shown promising results in research studies, indicating its potential as a diagnostic tool or therapeutic agent.RSV Antibody
The RSV Antibody is a highly effective antiviral treatment that utilizes monoclonal antibodies to combat respiratory syncytial virus (RSV) infections. These antibodies specifically target and neutralize the virus, preventing it from infecting healthy cells and spreading throughout the body.MDM4 antibody
The MDM4 antibody is a highly specialized monoclonal antibody that targets the growth factor MDM4. This antibody has been shown to be effective in inhibiting the activity of MDM4, which plays a crucial role in adipose tissue development. By binding to MDM4, the antibody prevents its activation and subsequent signaling pathways involved in adipogenesis. Additionally, this monoclonal antibody has been found to interact with histidine residues on MDM4, further enhancing its neutralizing effect.
DKK1 antibody
DKK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDLRPAP1 antibody
LRPAP1 antibody was raised using the C terminal of LRPAP1 corresponding to a region with amino acids IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHSFRS8 antibody
SFRS8 antibody was raised using the N terminal of SFRS8 corresponding to a region with amino acids MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDERJAZF1 antibody
JAZF1 antibody was raised in rabbit using the N terminal of JAZF1 as the immunogenDegré de pureté :Min. 95%CDKN1B antibody
The CDKN1B antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers and scientists working with polymerase chain reactions (PCR) and studying various biological processes. This monoclonal antibody specifically targets CDKN1B, which is a protein involved in cell cycle regulation.Estrogen Receptor alpha antibody (Ser104)
Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser104)
