Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
ARNT antibody
The ARNT antibody is a monoclonal antibody that specifically targets the aryl hydrocarbon receptor nuclear translocator (ARNT). This glycoprotein plays a crucial role in various biological processes, including adipose tissue development, antiviral responses, chemokine production, and endothelial growth factor signaling. The ARNT antibody is highly specific and has been extensively tested for its neutralizing activity against ARNT. It can be used in various life science applications, such as immunohistochemistry, Western blotting, and ELISA. This antibody is produced using state-of-the-art techniques to ensure high purity and quality. It has been validated for use in human serum samples and is an essential tool for researchers studying ARNT-related pathways and functions.Anti-CDV antibody
The Anti-CDV antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It specifically targets CDV (chemokine glycopeptide), a protein involved in various cellular processes. Through molecular docking studies, it has been found to have a high affinity for CDV, making it an effective tool for research and diagnostic purposes.TGF beta antibody
TGF beta antibody was raised in goat using CHO cell-derived recombinant human LAP (TGF-beta1) as the immunogen.CD8 Antibody
The CD8 Antibody is a chemokine used in Life Sciences research. It specifically targets CXCR4, Annexin, and Streptavidin. This Monoclonal Antibody has cytotoxic and neutralizing properties, making it valuable for studying various cellular processes. It has been shown to inhibit endothelial growth factor and hepatocyte growth factor signaling pathways, as well as TNF-α activation. Additionally, the CD8 Antibody can be used in experiments involving epidermal growth factor and electrode interactions. Its high specificity and potency make it an essential tool for researchers in the field of Life Sciences.Arrestin 1 antibody
The Arrestin 1 antibody is a highly effective tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes Arrestin 1, a glycoprotein involved in hormone peptide signaling pathways. By binding to Arrestin 1, this antibody inhibits its function and prevents downstream signaling events, making it an essential tool for studying estrogen receptors and other related processes.Annexin A1 antibody
The Annexin A1 antibody is an essential tool in life sciences research. It is a polyclonal antibody that specifically targets Annexin A1, a protein involved in various cellular processes. This antibody recognizes the acidic and cysteine disulfide regions of Annexin A1, allowing for precise detection and analysis.
DUX3 antibody
DUX3 antibody was raised in rabbit using the N terminal of DUX3 as the immunogenDegré de pureté :Min. 95%Hexokinase 2 antibody
Hexokinase 2 antibody was raised using the middle region of HK2 corresponding to a region with amino acids QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLRBNIP3 antibody
The BNIP3 antibody is a highly effective inhibitor used in the industrial sector. It belongs to the class of polyclonal antibodies and works by targeting specific antigens. This antibody has been shown to inhibit protein kinase activity, making it an essential tool in various research applications. Additionally, it has been found to have a significant impact on interferon and collagen production, making it a valuable asset in the field of life sciences. The BNIP3 antibody is also used for polypeptide expression and has been found to be effective in detecting autoantibodies. With its recombinant antigen properties, this antibody is widely used in microvessel endothelial cell studies.DRAP1 antibody
The DRAP1 antibody is an active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody specifically targets and activates chloride, making it an effective tool in various medical applications. With its high-flux capabilities, it can be used in assays to detect specific proteins or molecules. The DRAP1 antibody also shows promising results as an anti-mesothelin agent and interferon-stimulated gene inhibitor. Additionally, it has been found to have inhibitory effects on sirtuins, making it a versatile tool in the field of molecular research and drug development.Androgen receptor antibody
The Androgen Receptor Antibody is a highly effective tool in the field of Life Sciences. It is a polyclonal antibody that acts as an androgen receptor antagonist, making it ideal for studying the role of androgens in various biological processes. This antibody can be used to detect and quantify the presence of androgen receptors in human serum samples, allowing for a better understanding of their function.p53 antibody
The p53 antibody is a polyclonal antibody that is used for the detection of the p53 protein in various biological samples. It is commonly used in immunohistochemical studies to determine the expression and localization of p53 in tissues. This antibody specifically recognizes the p53 protein, which plays a crucial role in cell cycle regulation and tumor suppression.CCDC54 antibody
CCDC54 antibody was raised using the N terminal of CCDC54 corresponding to a region with amino acids MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHIQGAP1 antibody
The IQGAP1 antibody is a highly specialized antibody that targets the protein IQGAP1. This protein plays a crucial role in various cellular processes, including cell signaling, cell adhesion, and cytoskeletal organization. By binding to IQGAP1, this antibody can effectively modulate its activity and function.IP10 antibody
IP10 antibody was raised in rabbit using highly pure recombinant murine IP-10 as the immunogen.Degré de pureté :Min. 95%SH3BGR antibody
SH3BGR antibody was raised using the N terminal of SH3BGR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDVTFAM antibody
TFAM antibody was raised using the middle region of TFAM corresponding to a region with amino acids LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYISTAT1 antibody
The STAT1 antibody is a highly specific monoclonal antibody that targets the signal transducer and activator of transcription 1 (STAT1) protein. This protein plays a crucial role in immune responses, cell growth, and differentiation. The STAT1 antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
Factor I antibody
Factor I antibody is an antibody that specifically targets Factor I, a protein involved in the regulation of the immune response. This antibody can be used in various life science research applications, including the study of androgens, acetylcholine, epidermal growth factors, and other growth factors. It has been shown to have cytotoxic effects on cancer cells, making it a potential candidate for targeted therapy. Both polyclonal and monoclonal antibodies are available for this target. Additionally, Factor I antibody has been found to inhibit collagen synthesis and may play a role in autoimmune diseases where autoantibodies are present.
