Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
Bax antibody
The Bax antibody is a monoclonal antibody that specifically targets the Bax protein, an important regulator of apoptosis. This antibody recognizes both the amino-terminal and carboxyl-terminal regions of the Bax protein, making it highly effective in detecting and studying Bax expression in various biological samples.MIOX antibody
The MIOX antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It is specifically designed to target and bind to trastuzumab, a steroid-activated monoclonal antibody. The MIOX antibody has been extensively studied and proven to have low density, allowing for enhanced binding affinity to its target.
4EBP1 antibody
4EBP1 antibody was raised in Mouse using a purified recombinant fragment of 4EBP1 expressed in E. coli as the immunogen.SENP3 antibody
SENP3 antibody was raised using the N terminal of SENP3 corresponding to a region with amino acids PPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEETACC3 antibody
The TACC3 antibody is a highly specialized monoclonal antibody that is designed to target and bind to the TACC3 protein. This protein plays a crucial role in cell division and has been found to be overexpressed in various types of cancer, making it an important target for cancer research and treatment.PRPF38A antibody
PRPF38A antibody was raised in rabbit using the C terminal of PRPF38A as the immunogenFLJ25791 antibody
FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFLDHX38 antibody
DHX38 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 38 (Dhx38)
CXCL12 antibody
The CXCL12 antibody is a highly effective tool for researchers in the field of immunology. This antibody specifically targets and binds to CXCL12, a chemokine involved in immune responses. By binding to CXCL12, this antibody can modulate immune cell recruitment and activation.
Anti-CPV Antibody
The Anti-CPV Antibody is a cytotoxic monoclonal antibody that specifically binds to cytidine. It is commonly used in Life Sciences research and drug development. This antibody can be utilized in various applications, including electrode-based assays and nanocomposite or colloidal systems. The Anti-CPV Antibody has shown promising results in inhibiting the growth factor signaling pathway and neutralizing autoantibodies, such as insulin antibodies. With its high specificity and potency, this antibody is a valuable tool for studying activated pathways and developing targeted therapies.
SPR antibody
SPR antibody was raised in rabbit using the C terminal of SPR as the immunogenDegré de pureté :Min. 95%Estrogen Receptor alpha antibody (Ser167)
Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser167)BNP antibody
BNP antibody was raised in Mouse using synthetic peptide corresponding to aa (Gly-Leu-Gln-Glu-Gln-Arg-Asn-His-Leu-Gln-Gly-Lys-Leu-Cys) of human BNP, conjugated to KLH as the immunogen.Caveolin 1 antibody
The Caveolin 1 antibody is a powerful tool in the field of life sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody has been extensively studied and proven to be effective in various applications.OCIAD1 antibody
OCIAD1 antibody was raised using the C terminal of OCIAD1 corresponding to a region with amino acids QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKFCRL1 antibody
FCRL1 antibody was raised using the N terminal of FCRL1 corresponding to a region with amino acids MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFSELENBP1 antibody
SELENBP1 antibody was raised using the N terminal of SELENBP1 corresponding to a region with amino acids MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD
